Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b9mC_

Fold library idPDB HeaderMoleculeTitle
c6b9mC_1.68PDB header: transferaseChain: C: PDB Molecule: e3 ubiquitin-protein ligase uhrf1;


Added to library: Sat Feb 17 08:23:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LIDPGFGFYKINEFVDARDLNMGAWFEAQIVKVTKTPAEDGGPEEIVYHVKYEDYPENGVVQLRGKDVRP
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



SSSS

TT

TTT



STTS



TT
GGG
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence RARTVYQWRQLEPGMIVMVNYNPDDPKERGYWYDAEIQRKRETRTQREVFGKILLGDAGDSLNDCRIMFV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)



B

GGG

TT

SSSTTS


SS

SSTTSS
T
 .........150
Sequence TEIYKIEEPG
Predicted secondary structure


SS confidence









Known secondary structure (DSSP) T

B






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D