Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b82B_

Fold library idPDB HeaderMoleculeTitle
c6b82B_3.03PDB header: oxidoreductaseChain: B: PDB Molecule: cytochrome p450, family 17, subfamily a, polypeptide 1;


Added to library: Sat Dec 16 10:38:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RSPPSLPSLPIIGSLMSLVSDSPPHIFFQDLQKKYGDLYSLMMGSHKLLIVNNHHHAKEILIKKGKIFAG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



B



SSSBSGGG


SS
T
STT

TTTTTTS
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence RPRTVTTDLLTRDGKDIAFADYSSTWKFHRKMVHGALCMFGEGSVSIEKIICREASSMCEVLTESQNSAV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



TTTT
SSTTS
SS
SSSS

TTSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence DLGPELTRAVTNVVCALCFNSSYKRGDAEFESMLQYSQGIVDTVAKDSLVDIFPWLQIFPNKDLRILRQC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
BTS



TT
SSS

SGGGGGS

 .........220.........230.........240.........250.........260.........270.........280
Sequence ISIRDKLLQKKYEEHKVTYSDNVQRDLLDALLRAKRSSENNNSSTRDVGLTEDHVLMTVGEIFGAGVETT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

TT


STT
STTSSS

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence TTTLKWSIAYLVHNPQVQRKIQEELDSKIGKERHPQLSDRGNLPYLEATICEVMRIRPVSPLLIPHVALQ
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
T
SSS


GGGGGG
S
S
SB



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DSSVGEYTVQKGTRVVINMWSLHHDEKEWKNPELFDPGRFLNEEGDGLCCPSGSYLPFGAGVRVCLGEAL
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) STT
TT
B
TTTSSSTT


GGGGB
SSSSSB



TT

TT

GGG

TT
 .........430.........440.........450.........460.........470
Sequence AKMELFLFLAWILQRFTLEMPTGQPLPDLQGKFGVVLQPKKFKVVAKVRA
Predicted secondary structure



















SS confidence

















































Known secondary structure (DSSP)
STT







B
SSS
B




B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D