Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b5kA_

Fold library idPDB HeaderMoleculeTitle
c6b5kA_1.60PDB header: transferaseChain: A: PDB Molecule: glucose-1-phosphate thymidylyltransferase;


Added to library: Sat Feb 24 08:37:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


S

GGGTTS
GGGSB
SSSBTTTT


TTTTTSGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GTS
SS


TTTTTS
TTSTTSSGGGGGGGG
SS
S
GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence AYGVVEFLSLEEKPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GS








S
TTT



TTS


TT


TT
 .........220.........230.........240.........250.........260.........270.......
Sequence WLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLE
Predicted secondary structure





















SS confidence


































































Known secondary structure (DSSP)

S





TTSS
TTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D