Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b5kA_

Fold library idPDB HeaderMoleculeTitle
c6b5kA_1.60PDB header: transferaseChain: A: PDB Molecule: glucose-1-phosphate thymidylyltransferase;


Added to library: Sat Feb 24 08:37:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


S

GGGTTS
GGGSB
SSSBTTTT


TTTTTSGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GTS
SS


TTTTTS
TTSTTSSGGGGGGGG
SS
S
GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence AYGVVEFLSLEEKPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GS








S
TTT



TTS


TT


TT
 .........220.........230.........240.........250.........260.........270.......
Sequence WLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLE
Predicted secondary structure





















SS confidence


































































Known secondary structure (DSSP)

S





TTSS
TTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D