Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b3rE_

Fold library idPDB HeaderMoleculeTitle
c6b3rE_3.80PDB header: transport proteinChain: E: PDB Molecule: piezo-type mechanosensitive ion channel component 1;


Added to library: Sat Dec 23 08:44:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LVTGIYVKYWIYVCAGMFIVVSFAVYKIVYMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTMLVLIAV
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)



TTSTT
S



STTTT

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence YTFQFQDFPTYWRNLTGFTDEQLGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPFMQLTDLRLL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TSSS
SSS

TTTTTTTSS



SSSSSTTSS



 .........150.........160.........170.........180.........190.........200.........210
Sequence DLAASFSAVLTRIQVFVRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLST
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTSSSS

SS
TT
STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VWTCIIIVCKMLYQLKIVNPHNCTEPFPQPLEINQSLLYRGPVDPANWFGVRKGYPNLGYIQNHLQILLL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

SSS
TTT









TTGGGSSTTTS


TTTTTT



SSSSTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LVFEAVVYRRQEHYRRQHQQAPLPAQAVCADGTRQRLDQDLLSCLKYFINFFFYKFGLEICFLMAVNVIG
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTS


SSSS

SSTT

SSGGGT
TS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QRMNFMVILHGCWLVAILTRRRREAIARLWPNYCLFLTLFLLYQYLLCLGMPPALCIDYPWRWSKAIPMN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

STTTTS
STTTTTSS
SSS



TTSSGGGS


 .........430.........440.........450.........460.........470.........480.........490
Sequence SALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGINTDHLEPLRGEPNPIPNF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTT


SSS



TT

STTSSSS



S



S
S


SS


 .........500.........510.........520.........530.........540.........550.........560
Sequence IHCRSYLDMLKVAVFRYLFWLVLVVVFVAGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVLWDCL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) SS
SSSTTSS
STTS
TTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence ILYNVTVIISKNMLSLLSCVFVEQMQSNFCWVIQLFSLVCTVKGYYDPKEMMTRDRDCLLPVEEAGIIWD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SGGGTS
STTTSS
SSS
T




SSSS
TTTGGG

TT



SS


 .........640.........650.........660.........670.........680.........690.........700
Sequence SICFFFLLLQRRIFLSHYFLHVSADLKATALQASRGFALYNAANLKSINFHRQIEEKSLAQLKRQMKRIR
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) TST
 .........710.........720.........730.........740.........750.........760.........770
Sequence AKQEKYRQSQASHMMQRVLSTMQFLWVLGQATVDGLTRWLRAFTKHHRTMSDVLCAERYLLTQELLRVGE
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

TTTTTSTT
S
 .........780.........790.........800.........810.........820.........830.........840
Sequence VRRGVLDQLYVGEDEATLSGPVETRDGPHIPELEEAERFEAQQGRTLRLLRAGYQCVAAHSELLCYFIII
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) STT
S
SS
SSTTT



TT

TTTS
 .........850.........860.........870.........880.........890.........900.........910
Sequence LNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYVVLRRYENK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S

SSTTTSSSSSS

TT
SS
SGGGSTTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence PYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLWDQSFYQPLQRFFHDILHTKYRAATDVYALM
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTST



SS

SSTT




SSTT







 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence FLADIVDIIIIIFGFWAQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILQN
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) T



T
TT


 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence AVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTT
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT


S


S
SSSSS

STTSS

S
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence LSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)

S


SS




STTSS
S
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence VGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFISQYSPEDIVTAQI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT


S
B
BBTTS


B
TTTS
B

TTT
TS
TTS


 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence EGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTVEYTNEKHTLELAPNSTARRQLAQ
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SB







T

S



B




STTS
S









TT
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence LLEGRPDQSVVIPHLFPKYIRAPNGPEANPVKQLQPDEEEDYLGVRIQLRREQVGSDFLEWWVIELQDCK
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) T







SSS


B
TTT

STTTSS

S




S
TTTT
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence ADCNLLPMVIFSDKVSPPGYGIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SSSS







SSSSS
STTS
S

 .........1480.........1490.........1500..
Sequence ETRELELEEELYAKLIFLYRSPETMIKWTRER
Predicted secondary structure







SS confidence































Known secondary structure (DSSP) T
TS
T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D