Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b2wB_

Fold library idPDB HeaderMoleculeTitle
c6b2wB_2.50PDB header: hydrolaseChain: B: PDB Molecule: putative peptidyl-arginine deiminase family protein;


Added to library: Sat Dec 16 08:25:58 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ENLYFQGHMIKSIPEWSEQEYLMLSLPHEKSDWNPYLEEILQSYKEFVKVVSEFQKVLLIAPKQSDFENF
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



BTTB



TTS



TTSTTGGGTTSSSGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KDIKNVEFFKCDTNDTWIRDFGAIDIVENGRLKALDFTFNAWGNKFQSELDNAVNSKLFKEKFKEELKKV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
TT


S
S
S
TT

TS

TTGGGTT



 .........150.........160.........170.........180.........190.........200.........210
Sequence DFILEGGSIDFNGEGVMLTSSHCLLNENRNSHLNKTQIDTKLKEIFGLKQIIWLENGFIKGDDTDHHIDT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

GGG
SSSTSTTTTTTS
T
S
S


TT

SS

GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence LARFIDKNTIAHCICEDEEDEHYLPLQKMKEELKKTGFDLLELPIPKPLYYEERRLGATYANFVFINNAL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSSSS


TTSTTTT



S

BSSS
B



TT

TT
 .........290.........300.........310.........320.........330...
Sequence IVPFYKDKNDEIIAKRLSKALPNHKIIGVDARVFLRQNGSLHSSCQNRFKGLR
Predicted secondary structure



















SS confidence




















































Known secondary structure (DSSP)
SST
TTS
TTT

TGGG

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D