Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b2wB_

Fold library idPDB HeaderMoleculeTitle
c6b2wB_2.50PDB header: hydrolaseChain: B: PDB Molecule: putative peptidyl-arginine deiminase family protein;


Added to library: Sat Dec 16 08:25:58 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ENLYFQGHMIKSIPEWSEQEYLMLSLPHEKSDWNPYLEEILQSYKEFVKVVSEFQKVLLIAPKQSDFENF
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)



BTTB



TTS



TTSTTGGGTTSSSGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KDIKNVEFFKCDTNDTWIRDFGAIDIVENGRLKALDFTFNAWGNKFQSELDNAVNSKLFKEKFKEELKKV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
TT


S
S
S
TT

TS

TTGGGTT



 .........150.........160.........170.........180.........190.........200.........210
Sequence DFILEGGSIDFNGEGVMLTSSHCLLNENRNSHLNKTQIDTKLKEIFGLKQIIWLENGFIKGDDTDHHIDT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

GGG
SSSTSTTTTTTS
T
S
S


TT

SS

GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence LARFIDKNTIAHCICEDEEDEHYLPLQKMKEELKKTGFDLLELPIPKPLYYEERRLGATYANFVFINNAL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSSSS


TTSTTTT



S

BSSS
B



TT

TT
 .........290.........300.........310.........320.........330...
Sequence IVPFYKDKNDEIIAKRLSKALPNHKIIGVDARVFLRQNGSLHSSCQNRFKGLR
Predicted secondary structure



















SS confidence




















































Known secondary structure (DSSP)
SST
TTS
TTT

TGGG

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D