Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6azoC_

Fold library idPDB HeaderMoleculeTitle
c6azoC_2.46PDB header: hydrolaseChain: C: PDB Molecule: putative amidase;


Added to library: Sat Feb 24 08:30:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TNRHFIDADPYPWPYNGALRPDNTALIIIDXQTDFCGKGGYVDHXGYDLSLVQAPIEPIKRVLAAXRAKG
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)




B

BSS
BSTT



GGG

BSTTSTT

TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence YHIIHTREGHRPDLADLPANKRWRSQRIGAGIGDPGPCGRILTRGEPGWDIIPELYPIEGETIIDKPGKG
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP)

B
TT
TT

TT

BT
TTBTBTTSGGGSB
GGG


TT
SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SFCATDLELVLNQKRIENIILTGITTDVCVSTTXREANDRGYECLLLEDCCGATDYGNHLAAIKXVKXQG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSTTSSTT


TTTT

SS
 .........220.........230.
Sequence GVFGSVSNSAALVEALPGLVP
Predicted secondary structure





SS confidence




















Known secondary structure (DSSP) TT

T






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D