Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6az6B_

Fold library idPDB HeaderMoleculeTitle
c6az6B_1.91PDB header: transcriptionChain: B: PDB Molecule: gntr family transcriptional regulator;


Added to library: Sat Dec 23 09:11:05 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LVEQTADRLLHLILEREYPVGAKLPNEYELAEDLDVGRSTIREAVRSLATRNILEVRQGSGTYISSKKGV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
T

TT
B


T

TTSTTT
TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SEDPLGFSLIKDTDRLTSDLFELRLLLEPRIAELVAYRITDDQLQLLEKLVGDIEDAVHAGDPKHLLLDV
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
SSTT
GGG
S


TT
TT
 .........150.........160.........170.........180.........190.........200.....
Sequence EFHSXLAKYSGNIAXDSLLPVINQSIHLISDSLEAHREIIKAIREKNPVAAHDAXLXHIXSVRRS
Predicted secondary structure






SS confidence
































































Known secondary structure (DSSP) TT


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D