Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ayiA_

Fold library idPDB HeaderMoleculeTitle
c6ayiA_2.09PDB header: transcriptionChain: A: PDB Molecule: hth-type transcriptional regulator uidr;


Added to library: Sat Dec 23 10:12:25 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAIILQDQERALARFREPIEG
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)


T


SSSS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IHFVDYMVESIVSLTHEAFGQRALVVEIMAEGMRNPQVAAMLKNKHMTITEFVAQRMRDAQQKGEISPDI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
TTS
TT
TTSS
TTS
 .........150.........160.........170.........180...
Sequence NTAMTSRLLLDLTYGVLADIEAEDLAREASFAQGLRAMIGGIL
Predicted secondary structure









SS confidence










































Known secondary structure (DSSP)
T
TTTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D