Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ayhA_

Fold library idPDB HeaderMoleculeTitle
c6ayhA_2.05PDB header: transcriptionChain: A: PDB Molecule: tetr family transcriptional regulator;


Added to library: Sat Dec 23 10:16:26 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NKLTEPLPTRXRILRAARQCFAENGFHSTSXKTICKASDXSPGTLYHHFPSKEALIEAIILEDQERALTH
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TTSTT
TTT

T


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FREPLEGVGLVDYLVESTIAVTREDYAQRALVVEIXAEGXRNPQVAEXLTNKYHTIIASLVARFNDAQAK
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) SS


SS
S

T
 .........150.........160.........170.........180.........190..
Sequence GEIGADVDKEXAARLLLATTYGVLSDSSSAENARHVSFATTLRTMLTGLLKC
Predicted secondary structure
















SS confidence



















































Known secondary structure (DSSP) T
S
SS

T
TTTTSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D