Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6avwA_

Fold library idPDB HeaderMoleculeTitle
c6avwA_2.14PDB header: hydrolaseChain: A: PDB Molecule: carboxylesterase sober1;


Added to library: Sat Dec 30 08:46:52 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARTFILWLHGLGDSGPANEPIQTQFKSSELSNASWLFPSAPFNPVTCNNGAVMRSWFDVPEAPFKVGSPI
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)




TT

GGGGGG


SSSTT





GGGTT
SS



SSB
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence DESSVLEAVKNVHAIIDQEIAEGTNPENVFICGLSQGGALTLASVLLYPKTLGGGAVLSGWVPFTSSIIS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TTT

GGGTT
SS

SS



S
GGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence QFPEEAKKTPILWSHGTDDRMVLFEAGQAALPFLKEAGVTCEFKAYPGLGHSISNKELKYIESWIKRRLK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) GS
TGGGGS
TT
TTBTTT

TT

SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D