Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6avhA_

Fold library idPDB HeaderMoleculeTitle
c6avhA_3.01PDB header: ligase, plant proteinChain: A: PDB Molecule: gh3.15 acyl acid amido synthetase;


Added to library: Sat Feb 17 08:26:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DPTNQKACLSLLEDLTTNVKQIQDSVLEAILSRNAQTEYLRGFLNGQVDKQNFKKNVPVVTYEDIRSYID
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)




SS

TTTSGGGSSSS

SS

B
 .........80.........90.........100.........110.........120.........130.........140
Sequence RIANGEPSDLICDRPISVLLTPKLIPLTTEDLEQRISFSSLYAPLLYKHIDGLSEGKSLIFYFVTRESKT
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT

GGGT
SS







STTGGGS







 .........150.........160.........170.........180.........190.........200.........210
Sequence ANGLMVRTMVTSFLKSDSLQVSPHAITTCADTTQSMYCQLLCGLLERDNVARLGAPFASSFLKVIKFLED
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SSS




TTBSS
T
S
TGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence HWPELCSNIRTGRLSDWITDATCTSGIGKFLTAPNPELASLIEQECSKTSWEAILKRLWPKAKCIESIIT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



TT


T
S

SS

TT
TT



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GTMAQYIPLLEFYSGGLPLTSSFYGSSECFMGVNFNPLCKPSDVSYTIIPCMGYFEFLEVPVVVDLVDVK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) GGGGGGTT




SS

S

SS
GGG


TTSS


TTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence IGHDYEPVVTTFSGLYRYRVGDVLRATGFYNNAPHFCFVGRQKVVLSIDMDKTYEDDLLKAVTNAKLLLE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT

TTS
SS
STTSS
SSS

GGGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence PHDLMLMDFTSRVDSSSFPGHYVIYWELGSKVKFEPNRDVMEECCFTVEESLDAVYRKGRKNDKNIGPLE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) GGT
SSSS







S
TT

S


 .........500.........510.........520.........530.........540.......
Sequence IKVVKPGAFDELMNFFLSRGSSVSQYKTPRSVTNEEALKILEANVISEFLSRKIPSW
Predicted secondary structure




















SS confidence
























































Known secondary structure (DSSP)
TTTTT

TTT



SS


T

S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D