Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6apjA_

Fold library idPDB HeaderMoleculeTitle
c6apjA_3.10PDB header: transferaseChain: A: PDB Molecule: alpha-n-acetylgalactosaminide alpha-2,6-sialyltransferase


Added to library: Sat Dec 23 08:27:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TTTT
TT

TTS
SB

GGG

TT

GGG

TT

GGG
SGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KLFAPCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTXKNSLVSYW
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SS






GGGTTT

SSSS


TT

S

S
TG
 .........150.........160.........170.........180.........190.........200.........210
Sequence NLGFTSVPQGQDLQYIFIPSDIRDYVXLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISY
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) GGT
SS



SS


SS
S


SSTTTT


S


TTTB
 .........220.........230.........240.........250.........260.........270.........280
Sequence LTERFLKSKLINTHFLYXPSTGALXLLTALHTCDQVSAYGFITSNYWKFSDHYFEANHDLSLEAALWRDL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T


S











SS


TTGGGS
SSTT




 .........290.
Sequence HKAGILQLYQR
Predicted secondary structure





SS confidence










Known secondary structure (DSSP) TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D