Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6ap4B_

Fold library idPDB HeaderMoleculeTitle
c6ap4B_2.95PDB header: transferaseChain: B: PDB Molecule: dna polymerase iii subunit beta;


Added to library: Sat Dec 23 08:29:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHMRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTALSEGACLEAG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TTTTS

SS
SSGGGG
SS
SS

TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ETTVPARKLMEICKSLPTAALIDLQITEDQRCILKSGNSRFVLGTLPAEDYPLLTTENSQGTQVQVTQRE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
TT

SSSTT
B
GGGS









 .........150.........160.........170.........180.........190.........200.........210
Sequence LKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLRAVTTDGHRLALCEILASSTSSQLVQAIVPRKAVGEL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTGGGS
SS
SSGGGGTT
SS
S
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence QRLLSIEDEQLTLLIGRELLNVTINTPSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SS


SS


STT





S



S




 .........290.........300.........310.........320.........330.........340.........350
Sequence FKQSLQRVAILSNEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQSAPLEMSFNAQYLLDVLGVLD
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTS
TTT
TT
TT



SSSSSS

 .........360.........370.........380..
Sequence GDDVNMSMTEANQSVLVQDPAHPDQTYVVMPM
Predicted secondary structure













SS confidence































Known secondary structure (DSSP) SSS
SSS

SS
TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D