Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6aokA_

Fold library idPDB HeaderMoleculeTitle
c6aokA_1.88PDB header: hydrolaseChain: A: PDB Molecule: ceg4;


Added to library: Sat Jan 13 08:15:33 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRQNLYFQGXPKVIIFTDFDGTVTGKSGNETVFTEFYQSLLQGYKKDVEQDYKNTPXKDPIEAQALFEAK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


SS








TTTTBSS
GGGTTTSTBTT

TT



TTTS
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence YGKYNENFDHDQQDVDFLXSPEAVAFFHEVLKNDDVTVNIVTKNRAEYIKAVFKYQGFSDEEISKLTILE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


STT

TTSTTGGGSB
TT
TT
SS
TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence SGYKFNDVNSRLNHPTERANRVYILDDSPTDYAEXLRAVKGKGYNEEEIRGYRKNPGEFEWSQYLEDVRE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS
SS



S
SSTTT

GGG


TT


 ...
Sequence XFP
Predicted secondary structure

SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D