Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6aokA_

Fold library idPDB HeaderMoleculeTitle
c6aokA_1.88PDB header: hydrolaseChain: A: PDB Molecule: ceg4;


Added to library: Sat Jan 13 08:15:33 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRQNLYFQGXPKVIIFTDFDGTVTGKSGNETVFTEFYQSLLQGYKKDVEQDYKNTPXKDPIEAQALFEAK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)


SS








TTTTBSS
GGGTTTSTBTT

TT



TTTS
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence YGKYNENFDHDQQDVDFLXSPEAVAFFHEVLKNDDVTVNIVTKNRAEYIKAVFKYQGFSDEEISKLTILE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


STT

TTSTTGGGSB
TT
TT
SS
TT

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence SGYKFNDVNSRLNHPTERANRVYILDDSPTDYAEXLRAVKGKGYNEEEIRGYRKNPGEFEWSQYLEDVRE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS
SS



S
SSTTT

GGG


TT


 ...
Sequence XFP
Predicted secondary structure

SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D