Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6amgA_

Fold library idPDB HeaderMoleculeTitle
c6amgA_1.45PDB header: metal binding proteinChain: A: PDB Molecule: cytochrome p460;


Added to library: Sat Dec 23 08:28:41 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LNYGSFTKEHVLLTPKGYREWVFIGASVTPNELNDDKAAFPEFHNVYIDPTSWGHWKKTGEFRDGTVIVK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)




B
TT

BB

SSGGGS

GGGTTT

SS
S
SS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELAGVGSKASPSGNGYFPGEFNGIAAMVKDSKRYPERPGNWAFFGFESYEAKQGIIQTDETCAACHKEHA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TT
TTT
TTSGGG
S
TT
SB


GGGT
 .........150........
Sequence AHDMVFTQFYPVLRAGKP
Predicted secondary structure










SS confidence

















Known secondary structure (DSSP) SBTTB
GGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D