Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5zi3A_

Fold library idPDB HeaderMoleculeTitle
c5zi3A_2.10PDB header: oxidoreductaseChain: A: PDB Molecule: malate dehydrogenase;


Added to library: Sat Oct 27 08:28:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MVKVAILGASGGVGQPLSLLLKLSPYVSELALYDIRAAEGIGKDLSHINTNSSCVGYDKDSIENTLSNAQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTTSTTT
TT
SSSTSSSSS
TT
TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VVLIPAGVPRKPGLTRDDLFKMNAGIVKSLVTAVGKFAPNARILVISNPVNSLVPIAVETLKKMGKFKPG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)






SS


TTS
SS
TT


GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence NVMGVTNLDLVRAETFLVDYLMLKNPKIGQEQDKTTMHRKVTVIGGHSGETIIPIITDKSLVFQLDKQYE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) G


TT

GGGGGGT

SSGGG

SGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence HFIHRVQFGGDEIVKAKQGAGSATLSMAFAGAKFAEEVLRSFHNEKPETESLSAFVYLPGLKNGKKAQQL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTTTS


TTSS


SSTT
GGGSBT
 .........290.........300.........310.........320.........330.........
Sequence VGDNSIEYFSLPIVLRNGSVVSIDTSVLEKLSPREEQLVNTAVKELRKNIEKGKSFILD
Predicted secondary structure



















SS confidence


























































Known secondary structure (DSSP) T
TT

TT

T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D