Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z9aB_

Fold library idPDB HeaderMoleculeTitle
c5z9aB_2.79PDB header: lyaseChain: B: PDB Molecule: chorismate synthase;


Added to library: Sat Mar 3 08:34:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSGNTYGKLFTVTTAGESHGPALVAIVDGCPPGLELSARDLQRDLDRRKDEVEILSGVFEGKTTGTPIGL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




SSS

SSSS


TT
B

TT



SSTT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LIRNTRETAMRVAAGAIAKKYLAGLGIQVRGYMSQLGPIEIPFRSWDSVEQNAFFSPDPDKVPELEAYMD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


TTTT
TT




SGGGGGSTT

S
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence QLRRDQDSVGAKITVVAEGVPPGLGEPIFDRLDAELAHALMSINAVKGVEIGAGFASIAQSNNAGGILGG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T



S

TT

BTTTB
TSSSSSGGGGS

-

STTTT
 .........220.........230.........240.........250
Sequence ISSGQPIVAHLALKPTRATPIAEAMMAIVLLDQLLRQRGQ
Predicted secondary structure











SS confidence







































Known secondary structure (DSSP)
SS









Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D