Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z9aB_

Fold library idPDB HeaderMoleculeTitle
c5z9aB_2.79PDB header: lyaseChain: B: PDB Molecule: chorismate synthase;


Added to library: Sat Mar 3 08:34:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSGNTYGKLFTVTTAGESHGPALVAIVDGCPPGLELSARDLQRDLDRRKDEVEILSGVFEGKTTGTPIGL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)




SSS

SSSS


TT
B

TT



SSTT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LIRNTRETAMRVAAGAIAKKYLAGLGIQVRGYMSQLGPIEIPFRSWDSVEQNAFFSPDPDKVPELEAYMD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


TTTT
TT




SGGGGGSTT

S
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence QLRRDQDSVGAKITVVAEGVPPGLGEPIFDRLDAELAHALMSINAVKGVEIGAGFASIAQSNNAGGILGG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T



S

TT

BTTTB
TSSSSSGGGGS

-

STTTT
 .........220.........230.........240.........250
Sequence ISSGQPIVAHLALKPTRATPIAEAMMAIVLLDQLLRQRGQ
Predicted secondary structure











SS confidence







































Known secondary structure (DSSP)
SS









Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D