Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z7rA_

Fold library idPDB HeaderMoleculeTitle
c5z7rA_2.20PDB header: lyaseChain: A: PDB Molecule: short-chain-enoyl-coa hydratase;


Added to library: Sat Feb 17 08:37:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MELNNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGADISE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


SSTT

GGGTT
B

TT

STTT
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence MKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGIT
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT


SS

STTSSTT


GGGGT

 .........150.........160.........170.........180.........190.........200.........210
Sequence PGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMNTAKEIANKIVSNAPVAVKLS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
SSS



TTS
S

GGGS
 .........220.........230.........240.........250....
Sequence KQAINRGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKRK
Predicted secondary structure






SS confidence











































Known secondary structure (DSSP) TTS
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D