Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z7rA_

Fold library idPDB HeaderMoleculeTitle
c5z7rA_2.20PDB header: lyaseChain: A: PDB Molecule: short-chain-enoyl-coa hydratase;


Added to library: Sat Feb 17 08:37:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MELNNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGADISE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


SSTT

GGGTT
B

TT

STTT
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence MKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGIT
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT


SS

STTSSTT


GGGGT

 .........150.........160.........170.........180.........190.........200.........210
Sequence PGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMNTAKEIANKIVSNAPVAVKLS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
SSS



TTS
S

GGGS
 .........220.........230.........240.........250....
Sequence KQAINRGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKRK
Predicted secondary structure






SS confidence











































Known secondary structure (DSSP) TTS
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D