Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z72B_

Fold library idPDB HeaderMoleculeTitle
c5z72B_2.40PDB header: transcriptionChain: B: PDB Molecule: ccpc;


Added to library: Sat Mar 3 09:32:15 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GTLKLAVASIIGQHWLPKVLKTYVERYPNAKVSLITGWSSEMLKSLYEDQVHIGIIRGNPEWKGRKDYLM
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

TSTT


TTS
SS



SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TDHLYLVDTEISCIDDIAHTDRPFIQFKSDSTYFQEIQHWWHQKFKTSPKQTILVDQIETCKQMALHGIG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SS

SGGGGGT

S
B

SSSSS




S
TTSS
 .........150.........160.........170.........180.........190.......
Sequence YAILPSVTLEEEDNKMPLLDTKDHPIGRDTWLLGYEPAFELKQVQAFVSVIKDMLKQ
Predicted secondary structure

















SS confidence
























































Known secondary structure (DSSP) BGGG

S



B
TTS
B

TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D