Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z6oA_

Fold library idPDB HeaderMoleculeTitle
c5z6oA_1.70PDB header: hydrolaseChain: A: PDB Molecule: protease;


Added to library: Sat Mar 3 09:11:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ANVVQRNSPSWGLSRISSKKSGATDYVYDSTAGEGIVIYGVDTGIDIGHADFGGRAEWGTNTADNDDTDG
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)
TT
SST
SSTT


TTTTTT
S


TT
GGGTT
SS
S

S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NGHGTHTASTAAGSKFGVAKKASVVAVKVLGADGSGTNSQVIAGMDWAVKDSKSRGATGKSVMNMSLGGA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SS
TTT
SSTT

S
TTS


TT
TTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence YSRAMNDAAANVVRSGVFLSVAAGNEAQDASNSSPASAPNVCTIAASTNSDGSASFTNFGSVVDLYAPGK
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)

TT

SSSSBGGGTTTSTT

TTS
B
TT

BSTT


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DITAAYPGGGSKTLSGTSMAAPHVAGAAAYLMALEGTTTSSACARIVQDAITKISGAPKGTTTKLLYNGI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S
TTS

S





SS

TTS






 ..
Sequence NG
Predicted secondary structure

SS confidence

Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D