Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z55A_

Fold library idPDB HeaderMoleculeTitle
c5z55A_UNKPDB header: oncoproteinChain: A: PDB Molecule: inactive tyrosine-protein kinase transmembrane receptor


Added to library: Sat May 19 08:31:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)



B
TT
TT


S

BBTT

BB

TT

SSS




TTT
GGG
SS



B
GGG
SSS
BS
T
 .........80.....
Sequence NFKSDLCDIPACDSK
Predicted secondary structure











SS confidence














Known secondary structure (DSSP) T

B


B




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D