Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5z10C_

Fold library idPDB HeaderMoleculeTitle
c5z10C_3.97PDB header: membrane proteinChain: C: PDB Molecule: piezo-type mechanosensitive ion channel component 1;


Added to library: Sat Feb 3 08:33:25 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTM
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)

SSSSGGGTTTTTTTTTTT
SS

SSTTSSSS

GGGTT
TTSSSSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVLIAVYTFQFQDFPTYWGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPLLDLAASFSAVLTRI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) SSSSGGGTSSSSSSSS


GGG
GGGGTTTGGGTSTTSSTTTS


TTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QVFVRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMASCLSTVWTCIIIVCKMLY
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) S
TTSSGGGSSTT
S


SSSSTTTTSSTTSSSS
SSSTTTTTSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence QLKIVNPHEFGVRKGYPNLGYIQNHLQILLLLVFEAVVYRRQEHYPLPAQAVCADGTRQRLDQDLLSCLK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTTSS



SSS


TTGGGTTTTS





TTTTTT
STTTTTSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence YFINFFFYKFGLEICFLMAVNVIGQRMNFMVILHGCWLVAILTRRRREAIARLWPNYCLFLTLFLLYQYL
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) STTTTSTTTSGGGGTSS
STTGGGTTGGGTTT
SSS
TTTSSTTSSS

 .........360.........370.........380.........390.........400.........410.........420
Sequence LYLPDFFRAPNSTNLISDFLLLLCASQQWQRGEPNPIPNFIHCRSYLDMLKVAVFRYLFWLVLVVVFVAG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


TTTSTTTS



TTSTTTSSTTTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence ATISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVLWDCLILYNVTVIISKNMLSAGIIWDSICFFFLLLQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) T

TTTTTTTTS
TT




 .........500.........510.........520.........530.........540.........550.........560
Sequence RRIFLSHYFLHVSADLKATALQASRGFALYNAANLKSINFHRQIEEKSLAQLKRQMKRIRAKQEKYRQSQ
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)
SSTTTGGGTST
 .........570.........580.........590.........600.........610.........620.........630
Sequence ASAGRSHMMQRVLSTMQFLWVLGQATVDGLTRWLRAFTKHHRTELLANARTRMRTASELLLDRRLHIPEL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T


TTSTTTTTTT


SS

S
TTTSTT
TTTTTTT

 .........640.........650.........660.........670.........680.........690.........700
Sequence EEAERFEAQQGRTLRLLRAGYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRF
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT
TTT
S

-

SSSTTTTTSSS

SSSS
SS
 .........710.........720.........730.........740.........750.........760.........770
Sequence WMTAIVFTEVMVVTKYLFTDSYIKYDLVQLMALFFHRSQLLCYRAATDVYALMFLADIVDIIIIIFGFWA
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) SS





-

STTGGG









TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence FGKHSAATDIASSLSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILPA
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) GGGTTTT


TTTTT
TTTTTTTTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence VTNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)





SS



SS
SS

TSTTTTSS
 .........920.........930.........940.........950.........960.........970.........980
Sequence DTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLI
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

SS
STTTTSSTTTSS


TT



TTTTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFISQYSPEDIVT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S








STTT

S
TTT

TTTT
S
GGG
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence AQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTVEYTNEKHTLELAPNSTARRQ
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
B
SB
SS




S
SS


TTSS
S






TT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence LAQLLEGRPDQSVVIPHLFPKYIRAPNGPEANPVKQLQPDEEEDYLGVRIQLRREQVGTKASDFLEWWVI
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TTSS

TT







SSSS

SSSSTTSSSSS




S

 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence ELQDCKADCNLLPMVIFSDKVSPPSLGFLAGYGIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SS
SSTTS
B










TTTTTTTTTTTTTGGGSSS

S
T
 .........1270.........1280.........1290.........1300.....
Sequence ILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTRERE
Predicted secondary structure








SS confidence












































Known secondary structure (DSSP) T

SSSTTTS
TTSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D