Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yzcB_

Fold library idPDB HeaderMoleculeTitle
c5yzcB_2.33PDB header: viral proteinChain: B: PDB Molecule: glycoprotein f1,measles virus fusion protein;


Added to library: Sat Feb 24 08:58:22 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GVVLAGAALGVATAAQITAGIALHQSMLNSQAIDNLRASLETTNQAIEAIRQAGQEMILAVQGVQDYINN
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)








S

T


S

TTS


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELIPSMNQLSCDLIGQKLGLKLLRYYTEILSLFGPSLRDPISAEISIQALSYALGGDINKVLEKLGYSGG
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTGGGTTTS
STT


TTT

TTTTTTTTTS

TT

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLLGILESRGIKARITHVDTESYFIVLSIAYPTLSEIKGVIVHRLEGVSYNIGSQEWYTTVPKYVATQGY
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) STT
TTTT







TT




TT

STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LISNFDESSCTFMPEGTVCSQNALYPMSPLLQECLRGSTKSCARTLVSGSFGNRFILSQGNLIANCASIL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
GGGTTSS




TT
GGGS
SSS



TT
TTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence CKCYTTGTIINQDPDKILTYIAADHCPVVEVNGVTIQVGSRRYPDAVYLHRIDLGPPISLERLDVGTNLG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT

B



TT
S

TTT
STT

S

S




GGGS



B



 .........360.......
Sequence NAIAKLEDAKELLESSD
Predicted secondary structure

SS confidence
















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D