Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yz0D_

Fold library idPDB HeaderMoleculeTitle
c5yz0D_4.70PDB header: cell cycleChain: D: PDB Molecule: atr-interacting protein;


Added to library: Sat Feb 3 08:20:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQALSQC
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)


SSTTTTTTTTTTTSSTTTSS
TTTTTTSTTS
S
BTTB
SSTTT
TT

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence PAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNGEIKI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT


SSTTTTTTSTT
SS


SSS
SSS

SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence LRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMNELRTKLQTSERANK
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTTTTSSS
TTGGGGSSSSTTTTTS



STTSS
SSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKPHSLR
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) TTTTSS
SSSTTTTTTTSSS



SS
TT
 .........290.........300.........310........
Sequence GDSIKQEEAQKSFVDSWRQRSNTQGSILINLLLKQPLI
Predicted secondary structure






SS confidence





































Known secondary structure (DSSP) SS
SS

S

SSSSTTTTTTTTSSSSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D