Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yz0C_

Fold library idPDB HeaderMoleculeTitle
c5yz0C_4.70PDB header: cell cycleChain: C: PDB Molecule: atr-interacting protein;


Added to library: Sat Feb 3 08:25:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQA
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)



SSTTTTTTTSSTTS
SS
T
SS


TTTTT
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNG
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTS



SSTTTT

SSSST

SSTTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence EIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMNELRTKLQTSE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)


TTTS
SSS
SSTTS
GGG



S
S
TSS
TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence RANKLAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKP
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTTTTS


TTGGGTTT




SSSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence HSLRGDSIKQEEAQKSFVDSWRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGF
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT

SS
SSSSS
TT


STS

S
 .........360..
Sequence GSTLAGMSGLRT
Predicted secondary structure











SS confidence











Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D