Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yz0C_

Fold library idPDB HeaderMoleculeTitle
c5yz0C_4.70PDB header: cell cycleChain: C: PDB Molecule: atr-interacting protein;


Added to library: Sat Feb 3 08:25:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQA
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)



SSTTTTTTTSSTTS
SS
T
SS


TTTTT
SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence LSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNG
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTS



SSTTTT

SSSST

SSTTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence EIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMNELRTKLQTSE
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)


TTTS
SSS
SSTTS
GGG



S
S
TSS
TTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence RANKLAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKP
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTTTTS


TTGGGTTT




SSSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence HSLRGDSIKQEEAQKSFVDSWRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGF
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT

SS
SSSSS
TT


STS

S
 .........360..
Sequence GSTLAGMSGLRT
Predicted secondary structure











SS confidence











Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D