Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yz0A_

Fold library idPDB HeaderMoleculeTitle
c5yz0A_4.70PDB header: cell cycleChain: A: PDB Molecule: serine/threonine-protein kinase atr;


Added to library: Sat Feb 3 08:41:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTDSQPTSVMLLDF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TTTTT



SSSSSSS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence IQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLHKKICEVICSLLFLFKSKSPAI
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS
TTGGGT





 .........150.........160.........170.........180.........190.........200.........210
Sequence FGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLSQLDEHMGYLQSAPLQLMSMQNLEFIEVTLLM
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT
SGGGS
TTTS





SS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence VLTRIIAIVFFRRQELLLWQIGCVLLEYGSPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)


SSS
TTTTTT

S
SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence EMDTDQLKLYEEPLSKLIKTLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQ
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


TTSTTS
STTTTSTTT

S


 .........360.........370.........380.........390.........400.........410.........420
Sequence YFLKFVPAGYESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENLS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS

SST



SGGGGGTGGGTTT


SSS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S

S
TTTT
TTTT


TTTTTSSSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence GIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKLDLEA
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)



TTTT
S
T
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence TIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFAANLLTLSCRISDSYSPQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S


SSSSS


S


SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence AQSRCVFLLTLFPRRIFLEWRTAVYNWALQSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSD
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) GGGTSSTTSS

STTSTTTGGG
SST
 .........710.........720.........730.........740.........750.........760.........770
Sequence IVKKEFASILGQLVCTLHGMFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLK
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TT
SS
SS

STTTTTTS

SS
TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence KKIPSPVKLAFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDGF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTTTT
SSTTTTTS

SSSSS

TTS

 .........850.........860.........870.........880.........890.........900.........910
Sequence IKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKSASVSGAAYTEI
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TTT


SSSS
TTT
ST

SS

 .........920.........930.........940.........950.........960.........970.........980
Sequence RALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVRKQDVAHQREMALNTLSEIANV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TT


TTTTTTT

STTT

 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence FDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQLNVNRREILINNFKYIFSHLVCSCSKDELER
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTS

SS

ST



ST

S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence ALHYLKNETEIELGSLLASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALN
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) T

TT
SSTTS
SSTSSS

TT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence SLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCFVTGVEDSSFAYGLLMELTRAYLAYADNSRA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTSS

SSS



SSS




SS
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence QDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTSSSSS



STTSSTTS












TTTTT
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence GSNFAEWSASWAGYLITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIM
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SSSTTSS
S
S
TT
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence AVLKHDDDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKDSMVSTVDYEDYQSVTRFLDLIPQDTLAVAS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




S
S
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence FRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SSSSSS


TTT
TT
SS





 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence RDATACYDRAIQLEPDQIIHYHGVVKSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWD
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTTT


TTTT

SS
SGGGTTTTTTSTTTSS

 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence LVENYLAADGKSTTWSVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLH
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TT
SSS

SS

TS



SSGGGTT
 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence MLCELEHSIKPLFQVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMVGECWLQSARVARKAGHHQT
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)




S
TTTGGGGS
TTSTTTGGGTTS
SS
TTS
 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence AYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFPENETPPEGKNMLIHGRAMLLVGRF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SS

TTTTSS

TTSS
TSSGGGS

SS



TTTT
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence MEETANFESNAIMKKYKDVTACLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYG
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TTSS

S
TS
STTTTSSSSS

TT
 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence NQFIYQSMPRMLTLWLDYGTKAYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
SSTTTT
STS
TTTTT
 .........1900.........1910.........1920.........1930.........1940.........1950.........1960
Sequence CHSHDEVFVVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLT
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) T


SSSSTTSSS
TTTGGG
 .........1970.........1980.........1990.........2000.........2010.........2020.........2030
Sequence DKLLELCNKPVDGHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEWAYIAGFDDMVEIL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) STT


T


S


B


TTTTS




SS









B

S

S
 .........2040.........2050.........2060.........2070.........2080.........2090.........2100
Sequence ASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNDE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTT




SSS




SS

SST







SSS
 .........2110.........2120.........2130.........2140.........2150.........2160.........2170
Sequence CGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


SSB

T




TTTTTSS


TTS
TTS
STT
 .........2180.........2190.........2200.........2210.........2220.........2230.........2240
Sequence FPDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S
STTTT




TTTBSSS



TTS
TTSSS


SSS
 .........2250.........2260.........2270.........2280.........2290.........2300.........2310
Sequence RLTHNMVNGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKLNETGEVVNEKAKTHV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


S
TTTTTT
STS
SSS





SS




TT
 .........2320.........2330.........2340.........2350.........2360..
Sequence LDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Predicted secondary structure




















SS confidence



















































Known secondary structure (DSSP) TTTTT

S

TT






TTS
TTS
GGG
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D