Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yybA_

Fold library idPDB HeaderMoleculeTitle
c5yybA_2.48PDB header: sugar binding proteinChain: A: PDB Molecule: putative abc transporter periplasmic binding protein;


Added to library: Sat Oct 27 08:47:48 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSTIEAGIAYPISTGFDPLTSSGASSXAANLHIFEGLVDLHPVTRQPYLALAAKEPEQKDDLTYYISLRE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


S


S
S
TTT

S


S
TTT

SSBSSS
TTB
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GAXFHDGSPVTTEDVVYSFERVLDPAKASLFAQFIPFIASVTALDDNVVEFKLKYPFALFKERLTIIKIV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T
B
TTS
B


GGG

S
GGG
TT
SSSSS

TTGGGS


 .........150.........160.........170.........180.........190.........200.........210
Sequence PKHIVEAGQSAFDAKPIGSGPYKFVSATKDDRIVFEANTVYNGHYPAKVEKXTWFLLSDDAARVTAQESG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT
S



SSTTT
TT

SSS

SSS

ST
 .........220.........230.........240.........250.........260.........270.........280
Sequence RVQAIESVPYLDAERLKRKNNVESVQSFGLLFLXFNCEKAPFDNPKVRQALHYALDKQKLIDIVFLGNAK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSSSS

GGGTTTS
TTSTTTTST

TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AATSYLQDTHPDYVKASSQYDYDKAKAEKLLAEAGITNLTFQLLATDHAWVKECAPLILESWNALSVVKV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SSSS
TTSTT



S



S
T
SS

STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence TLQHLQSGALYSAHVDKGAYEVVIAPGDPSVFGNDLDLLLSWWYRGDVWPKRRFRWANTAEYHEVQKLLD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TTTTT

S
GGGG


SSSTTTTTTS

TTS
 .........430.........440.........450.........460.........470.........480..
Sequence EAIKNPAGSKVAWQKAINIIAEQVPLYPIIHRKLPTAWNTKKLTDFQPLPTTGLSFLGVGRT
Predicted secondary structure
















SS confidence





























































Known secondary structure (DSSP)
GGG
S
TTTS



SSSS


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D