Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yxaC_

Fold library idPDB HeaderMoleculeTitle
c5yxaC_2.10PDB header: viral proteinChain: C: PDB Molecule: non-structural protein 1;


Added to library: Sat Jan 27 08:16:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVDCDGAILGAAVNGKKSAHGSPTFWMGSHEVNGTWMIHTLETLDYKECEWPLTHTIGTSVEESDMFMPR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

B

GGG
TTTTTTS




B

GGG
SS

S
GGG
SS
G
 .........80.........90.........100.........110.........120.........130.........140
Sequence SIGGPVSSHNRIPGYKVQTNGPWMQVPLEVKREVCPGTSVVVDSNCDGRGKSTRSTTDSGKIIPEWCCRS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) GGT

SSTTS
BTTB


TTS
TTS
SS

TT


TTS

S


BBSB
TT

B


SS
 .........150.........160.........170.......
Sequence CTMPPVSFHGSDGCWYPMEIRPMKTSDSHLVRSWVTA
Predicted secondary structure



















SS confidence




































Known secondary structure (DSSP)

SS
TT

TT

S

GGG

B





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D