Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yxaC_

Fold library idPDB HeaderMoleculeTitle
c5yxaC_2.10PDB header: viral proteinChain: C: PDB Molecule: non-structural protein 1;


Added to library: Sat Jan 27 08:16:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVDCDGAILGAAVNGKKSAHGSPTFWMGSHEVNGTWMIHTLETLDYKECEWPLTHTIGTSVEESDMFMPR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

B

GGG
TTTTTTS




B

GGG
SS

S
GGG
SS
G
 .........80.........90.........100.........110.........120.........130.........140
Sequence SIGGPVSSHNRIPGYKVQTNGPWMQVPLEVKREVCPGTSVVVDSNCDGRGKSTRSTTDSGKIIPEWCCRS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) GGT

SSTTS
BTTB


TTS
TTS
SS

TT


TTS

S


BBSB
TT

B


SS
 .........150.........160.........170.......
Sequence CTMPPVSFHGSDGCWYPMEIRPMKTSDSHLVRSWVTA
Predicted secondary structure



















SS confidence




































Known secondary structure (DSSP)

SS
TT

TT

S

GGG

B





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D