Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yw2D_

Fold library idPDB HeaderMoleculeTitle
c5yw2D_2.28PDB header: transferaseChain: D: PDB Molecule: adenine phosphoribosyltransferase;


Added to library: Sat Jan 6 08:16:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DDKMNLDFIKSKIAAVPDFPKPGIMFRDITPLLADPQGLRKTAEAMAQELKNKGIQPTIVAGTESRGFIF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
ST
SSTT

STTT


STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GVALAEVLGLGFVPVRKPGKLPRATYSVKYDLEYGSDSLEIHQDAFKVTDEVLVVDDLLATGGTAKATVD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT
B
TTS

S

SSSTTSS
TT
SSS
 .........150.........160.........170........
Sequence LIEKTQAKVAGLIFVMELDGLGGREVLAGYNVSALIKF
Predicted secondary structure













SS confidence





































Known secondary structure (DSSP) TTTT

TTS
TTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D