Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yvmA_

Fold library idPDB HeaderMoleculeTitle
c5yvmA_2.12PDB header: oxidoreductaseChain: A: PDB Molecule: alcohol dehydrogenase;


Added to library: Sat Dec 30 08:32:19 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMRMEFRHNLPSSDIIFGSGTLEKIGEETKKWGDKAILVTGKSNMKKLGFLADAIDYLESAGVETVHYGE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)













TTGGGG
SSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IEPNPTTTVVDEGAEIVLEEGCDVVVALGGGSSMDAAKGIAMVAGHSAEERDISVWDFAPEGDKETKPIT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SS
BT

S

SS



GGGGS

TT






 .........150.........160.........170.........180.........190.........200.........210
Sequence EKTLPVIAATSTSGTGSHVTPYAVITNPETKGKPGFGNKHSFPKVSIVDIDILKEMPPRLTAITGYDVFS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTS



SS

GGG
S

B
TTT





GGGS
STTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HVSENLTAKGDHPTADPLAIRAIEYVTEYLLRAVEDGEDIKAREKMAVADTYAGLSNTISGTTLRHAMAH
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SSS

TTT
TT
S


 .........290.........300.........310.........320.........330.........340.........350
Sequence PISGYYPDISHGQALASISVPIMEHNIENGDEKTWERYSRIAVALDASKPVDNTRQAASKAVDGLKNLLR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) STTS
T

TTS
SS


S
 .........360.........370.........380.........390.........400...
Sequence SLDLDKPLSELGVEEEKIPEMTEGAFIYMGGGIEANPVDVSKEDVKEIFRKSL
Predicted secondary structure























SS confidence




















































Known secondary structure (DSSP) TT



GGGGT

GGG
SSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D