Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yvmA_

Fold library idPDB HeaderMoleculeTitle
c5yvmA_2.12PDB header: oxidoreductaseChain: A: PDB Molecule: alcohol dehydrogenase;


Added to library: Sat Dec 30 08:32:19 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMRMEFRHNLPSSDIIFGSGTLEKIGEETKKWGDKAILVTGKSNMKKLGFLADAIDYLESAGVETVHYGE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)













TTGGGG
SSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IEPNPTTTVVDEGAEIVLEEGCDVVVALGGGSSMDAAKGIAMVAGHSAEERDISVWDFAPEGDKETKPIT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
SS
BT

S

SS



GGGGS

TT






 .........150.........160.........170.........180.........190.........200.........210
Sequence EKTLPVIAATSTSGTGSHVTPYAVITNPETKGKPGFGNKHSFPKVSIVDIDILKEMPPRLTAITGYDVFS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTS



SS

GGG
S

B
TTT





GGGS
STTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence HVSENLTAKGDHPTADPLAIRAIEYVTEYLLRAVEDGEDIKAREKMAVADTYAGLSNTISGTTLRHAMAH
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SSS

TTT
TT
S


 .........290.........300.........310.........320.........330.........340.........350
Sequence PISGYYPDISHGQALASISVPIMEHNIENGDEKTWERYSRIAVALDASKPVDNTRQAASKAVDGLKNLLR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) STTS
T

TTS
SS


S
 .........360.........370.........380.........390.........400...
Sequence SLDLDKPLSELGVEEEKIPEMTEGAFIYMGGGIEANPVDVSKEDVKEIFRKSL
Predicted secondary structure























SS confidence




















































Known secondary structure (DSSP) TT



GGGGT

GGG
SSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D