Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yudA_

Fold library idPDB HeaderMoleculeTitle
c5yudA_4.28PDB header: immune systemChain: A: PDB Molecule: baculoviral iap repeat-containing protein 1e;


Added to library: Sat Jan 6 08:37:24 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DRISEIDYEFLPELSALLGVDAFQVAKSQEEEEHKERMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)











SGGGTSS
STTS







GGGTTTS
TT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence EMAAAGFYHTGVRLGVQCFCCSLILFGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKRPEKML
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

SSTT

SSS


S

TTS


SSTTTT





S

SSTTSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RGGKARYHEEEARLESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
SS

SSGGGGTSTTS
S
S
TT
SSTT
TTTT



TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence WFPKCEFLQSKKSSEEIAQYIQSYEGFVSEQLRDNYTKATFRHMNLPEVCSSLGTDHLLSCDVSIISKHI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TT
TTS
ST

SS



TTSSSSSS
SSS

SSSS








S
 .........290.........300.........310.........320.........330.........340.........350
Sequence SQPVQEALTIPEVFSNLNSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS



B

T

SS



SSSSSS
S
S



STTTTS


 .........360.........370.........380.........390.........400.........410.........420
Sequence ANIICAQLLGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTS

SS

TTTTSSTT


SS
S

TT





T
STTT

GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence VRDIRLYLGTSLEIQEFPFYNTVSVLRKFFSHDIICVEKLIIYFIDNKDLQGVYKTPLFVAAVCTDWIQN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTS
S





S


SS
STS

ST

SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ASAQDKFQDVTLFQSYMQYLSLKYKATAEPLQATVSSCGQLALTGLFSSCFEFNSDDLAEAGVDEDEKLT
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS
S
S
TTTTS







TTTT
GGG

 .........570.........580.........590.........600.........610.........620.........630
Sequence TLLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQIDSPLKAINSFNIFLYY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT



SSSS

S
TT
TT

TTTTT

STTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence VSSHSSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESSSSFVSEHLL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TTTT
SS


S
S



SGGGG
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence RLALIFAYESNTVAECSPFILQFLRGKTLALRVLNLQYFRDHPESLLLLRSLKVSINGNKMSSYVDYSFK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TSS

TTTTTTTT
STTSS



S






STTGGGGGG
 .........780.........790.........800.........810.........820.........830.........840
Sequence TYFENLQPPAIDEEYTSAFEHISEWRRNFAQDEEIIKNYENIRPRALPDISEGYWKLSPKPCKIPKLEVQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGGTTTS




TTTTTT







S
SSTTSSS


 .........850.........860.........870.........880.........890.........900.........910
Sequence VNNTDAADQALLQVLMEVFSASQSIEFRLFNSSGFLESICPALELSKASVTKCSMSRLELSRAEQELLLT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

GGG

TT
SS
SSTT




S
SS

TTTTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence LPALQSLEVSETNQLPEQLFHNLHKFLGLKELCVRLDGKPNVLSVLPREFPNLLHMEKLSIQTSTESDLS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



S

SS







TT
TTT

SS


SS


SSTT
TTSTT


S





SSS

 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence KLVKFIQNFPNLHVFHLKCDFLSNCESLMAVLASCKKLREIEFSGRCFEAMTFVNILPNFVSLKILNLKD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGGS




S




S
STS

S
S





SS


STTTTTGGG



S




S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence QQFPDKETSEKFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLTFHDILDDDSVIEIARA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


S
T


S






SSGGGGGGGGGG
SS





SS

TTT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence ATSGGFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQELNICRNIPGRIQVQATTVKALGQCVSRLPS
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSSSTT



STT

GGGTTT

S
TT




SS



TTTT


S
 .........1200.........1210.........1220.........1230........
Sequence LIRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKLIVPFSPVILE
Predicted secondary structure






























SS confidence















































Known secondary structure (DSSP)
SS



TTTTS
SS


B





S




GGGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D