Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yudA_

Fold library idPDB HeaderMoleculeTitle
c5yudA_4.28PDB header: immune systemChain: A: PDB Molecule: baculoviral iap repeat-containing protein 1e;


Added to library: Sat Jan 6 08:37:24 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DRISEIDYEFLPELSALLGVDAFQVAKSQEEEEHKERMKMKKGFNSQMRSEAKRLKTFETYDTFRSWTPQ
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)











SGGGTSS
STTS







GGGTTTS
TT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence EMAAAGFYHTGVRLGVQCFCCSLILFGNSLRKLPIERHKKLRPECEFLQGKDVGNIGKYDIRVKRPEKML
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

SSTT

SSS


S

TTS


SSTTTT





S

SSTTSTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RGGKARYHEEEARLESFEDWPFYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT
SS

SSGGGGTSTTS
S
S
TT
SSTT
TTTT



TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence WFPKCEFLQSKKSSEEIAQYIQSYEGFVSEQLRDNYTKATFRHMNLPEVCSSLGTDHLLSCDVSIISKHI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TT
TTS
ST

SS



TTSSSSSS
SSS

SSSS








S
 .........290.........300.........310.........320.........330.........340.........350
Sequence SQPVQEALTIPEVFSNLNSVMCVEGETGSGKTTFLKRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS



B

T

SS



SSSSSS
S
S



STTTTS


 .........360.........370.........380.........390.........400.........410.........420
Sequence ANIICAQLLGAGGCISEVCLSSSIQQLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTS

SS

TTTTSSTT


SS
S

TT





T
STTT

GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence VRDIRLYLGTSLEIQEFPFYNTVSVLRKFFSHDIICVEKLIIYFIDNKDLQGVYKTPLFVAAVCTDWIQN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTS
S





S


SS
STS

ST

SSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ASAQDKFQDVTLFQSYMQYLSLKYKATAEPLQATVSSCGQLALTGLFSSCFEFNSDDLAEAGVDEDEKLT
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS
S
S
TTTTS







TTTT
GGG

 .........570.........580.........590.........600.........610.........620.........630
Sequence TLLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQIDSPLKAINSFNIFLYY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT



SSSS

S
TT
TT

TTTTT

STTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence VSSHSSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESSSSFVSEHLL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

TTTT
SS


S
S



SGGGG
S
 .........710.........720.........730.........740.........750.........760.........770
Sequence RLALIFAYESNTVAECSPFILQFLRGKTLALRVLNLQYFRDHPESLLLLRSLKVSINGNKMSSYVDYSFK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TSS

TTTTTTTT
STTSS



S






STTGGGGGG
 .........780.........790.........800.........810.........820.........830.........840
Sequence TYFENLQPPAIDEEYTSAFEHISEWRRNFAQDEEIIKNYENIRPRALPDISEGYWKLSPKPCKIPKLEVQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGGTTTS




TTTTTT







S
SSTTSSS


 .........850.........860.........870.........880.........890.........900.........910
Sequence VNNTDAADQALLQVLMEVFSASQSIEFRLFNSSGFLESICPALELSKASVTKCSMSRLELSRAEQELLLT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

GGG

TT
SS
SSTT




S
SS

TTTTT
 .........920.........930.........940.........950.........960.........970.........980
Sequence LPALQSLEVSETNQLPEQLFHNLHKFLGLKELCVRLDGKPNVLSVLPREFPNLLHMEKLSIQTSTESDLS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



S

SS







TT
TTT

SS


SS


SSTT
TTSTT


S





SSS

 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence KLVKFIQNFPNLHVFHLKCDFLSNCESLMAVLASCKKLREIEFSGRCFEAMTFVNILPNFVSLKILNLKD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGGS




S




S
STS

S
S





SS


STTTTTGGG



S




S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence QQFPDKETSEKFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCLQLPCLRVLTFHDILDDDSVIEIARA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)


S
T


S






SSGGGGGGGGGG
SS





SS

TTT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence ATSGGFQKLENLDISMNHKITEEGYRNFFQALDNLPNLQELNICRNIPGRIQVQATTVKALGQCVSRLPS
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSSSTT



STT

GGGTTT

S
TT




SS



TTTT


S
 .........1200.........1210.........1220.........1230........
Sequence LIRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKLIVPFSPVILE
Predicted secondary structure






























SS confidence















































Known secondary structure (DSSP)
SS



TTTTS
SS


B





S




GGGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D