Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ytiA_

Fold library idPDB HeaderMoleculeTitle
c5ytiA_2.75PDB header: structural proteinChain: A: PDB Molecule: flagellar hook associated protein type 3 flgl;


Added to library: Sat Jan 20 09:55:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QIELIKQRINNIELFQNNRQAADSALRLEEGILSNAVNSLHRLREIQIQAGNPSLSEEDRKTLAVEAQAL
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
TT
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LNQLLDYANTKDSNGSYXFSGSKSLTQPVSLNLSGQYVYNGDSTQRFQAVTTSLLVAVNDTGDNVFXRIP
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) T
B
TTSSBTTSTT
TTS
S
TTSS
S




TT



TT

B
 .........150.........160.........170.........180.........190.........200.........210
Sequence SGNGRFAIRETLTPNTGTASVSSGSVTNEAAFVPDNYTXTFALNSQGNLVVXVSGTLSGNVIPPSGLPDD
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP) STTSS
SS

SS






TTT





SSS
TTTSTT

GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence APLYQEGSAIGFNGXEXVVSGLPKAGDSFSISPAKNESIFSTVQRXINNLNKPYTSSVEKAATQTENNQL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S
B

TT
TTS


TT


B

TS

SSTT
 .........290.........300.........310.........320.........330
Sequence LAQIDSALGHILSVQSDLGARLNQLETAEKANNDYLDISAATLKKLREID
Predicted secondary structure



SS confidence

















































Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D