Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ytiA_

Fold library idPDB HeaderMoleculeTitle
c5ytiA_2.75PDB header: structural proteinChain: A: PDB Molecule: flagellar hook associated protein type 3 flgl;


Added to library: Sat Jan 20 09:55:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QIELIKQRINNIELFQNNRQAADSALRLEEGILSNAVNSLHRLREIQIQAGNPSLSEEDRKTLAVEAQAL
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
TT
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LNQLLDYANTKDSNGSYXFSGSKSLTQPVSLNLSGQYVYNGDSTQRFQAVTTSLLVAVNDTGDNVFXRIP
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) T
B
TTSSBTTSTT
TTS
S
TTSS
S




TT



TT

B
 .........150.........160.........170.........180.........190.........200.........210
Sequence SGNGRFAIRETLTPNTGTASVSSGSVTNEAAFVPDNYTXTFALNSQGNLVVXVSGTLSGNVIPPSGLPDD
Predicted secondary structure
































































SS confidence





































































Known secondary structure (DSSP) STTSS
SS

SS






TTT





SSS
TTTSTT

GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence APLYQEGSAIGFNGXEXVVSGLPKAGDSFSISPAKNESIFSTVQRXINNLNKPYTSSVEKAATQTENNQL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S
B

TT
TTS


TT


B

TS

SSTT
 .........290.........300.........310.........320.........330
Sequence LAQIDSALGHILSVQSDLGARLNQLETAEKANNDYLDISAATLKKLREID
Predicted secondary structure



SS confidence

















































Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D