Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ys9A_

Fold library idPDB HeaderMoleculeTitle
c5ys9A_2.50PDB header: oxidoreductaseChain: A: PDB Molecule: acyl-coenzyme a oxidase 3;


Added to library: Sat Mar 3 08:39:32 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ANVEIDGKQYNTFTEPPKALAGERAKVKFPIKDMTEFLHGGEENVTMIERLMTELERDPVLNVSGDYDMP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TT
TTTSTT

S
TST
TTT

TTGGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence KEQLRETAVARIAALSGHWKKDTEKEALLRSQLHGIVDMGTRIRLGVHTGLFMGAIRGSGTKEQYDYWVR
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) GGGTTT

TTT
TS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KGAADVKGFYGCFAMTELGHGSNVAGLETTATYIQDTDEFIINTPNTGATKWWIGGAAHSATHTACFARL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTTTTTSS



BSS
SS
GGG


TTTT

SGGG
TTTTTT
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence LVDGKDYGVKIFVVQLRDVSSHSLMPGIALGDIGKKMGRDAIDNGWIQFTNVRIPRQNMLMKYAKVSSTG
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TT
B
TTT

B
TT



SS
TTS

SSGGGB

SSS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KVSQPPLAQLTYGALIGGRVTMIADSFFVSQRFITIALRYACVRRQFGTTPGQPETKIIDYPYHQRRLLP
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)




S




B




TTS


BGGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LLAFTYAMKMAADQSQIQYDQTTDLLQTIDPKDKGALGKAIVDLKELFASSAGLKAFTTWTCANIIDQCR
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
TT

 .........430.........440.........450.........460.........470.........480.........490
Sequence QACGGHGYSGYNGFGQAYADWVVQCTWEGDNNVLCLSMGRGLIQSCLGHRKGKPLGSSVGYLANKGLEQA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTGGGGG
GGGSGGGGTSSS
TT



GGGGGGG
GGGTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence TLSGRDLKDPKVLIEAWEKVANGAIQRATDKFVELTKGGLSPDQAFEELSQQRFQCAKIHTRKHLVTAFY
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)

TT

TT
TT

T
 .........570.........580.........590.........600.........610.........620.........630
Sequence ERINASAKADVKPYLINLANLFTLWSIEEDSGLFLREGFLQPKDIDQVTELVNHYCKEVRDQVAGYTDAF
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)

TTTTTSS
TTT
 .........640.........650.........660.........670.........680.........690..
Sequence GLSDWFINAPIGNYDGDVYKHYFAKVNQQNPAQNPRPPYYESTLRPFLFREDEDDDICELDE
Predicted secondary structure



























SS confidence





























































Known secondary structure (DSSP)




GGG
TT

S

S

S
TTTTTTT













Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D