Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yqrA_

Fold library idPDB HeaderMoleculeTitle
c5yqrA_2.40PDB header: transport proteinChain: A: PDB Molecule: endolysin/membrane-anchored lipid-binding protein lam6


Added to library: Sat Feb 3 08:21:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAITNGVITKDEAEKLFNQDVDA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)




SS

SSS
TTT


SSST


SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence AVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTP
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T
TTS
T
TT
TTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NRAKRVITTFRTGTWDAYGSEANKKFRQMFKPLAPNTRLITDYFCYFHREFPYQGRIYLSNTHLCFNSTV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SSSGGGS
S



TT

SSSSS
S
 .........220.........230.........240.........250.........260........
Sequence LNWMAKLQIPLNEIKYLDKVTTNSSAISVETVTNRYTFSGFIARDEVFQLITRVWSKE
Predicted secondary structure
















SS confidence

























































Known secondary structure (DSSP) TT


GGG
TT
TT
SS


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D