Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yqrA_

Fold library idPDB HeaderMoleculeTitle
c5yqrA_2.40PDB header: transport proteinChain: A: PDB Molecule: endolysin/membrane-anchored lipid-binding protein lam6


Added to library: Sat Feb 3 08:21:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAITNGVITKDEAEKLFNQDVDA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)




SS

SSS
TTT


SSST


SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence AVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTP
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T
TTS
T
TT
TTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NRAKRVITTFRTGTWDAYGSEANKKFRQMFKPLAPNTRLITDYFCYFHREFPYQGRIYLSNTHLCFNSTV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SSSGGGS
S



TT

SSSSS
S
 .........220.........230.........240.........250.........260........
Sequence LNWMAKLQIPLNEIKYLDKVTTNSSAISVETVTNRYTFSGFIARDEVFQLITRVWSKE
Predicted secondary structure
















SS confidence

























































Known secondary structure (DSSP) TT


GGG
TT
TT
SS


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D