Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ym0A_

Fold library idPDB HeaderMoleculeTitle
c5ym0A_1.84PDB header: lyaseChain: A: PDB Molecule: dihydroxy-acid dehydratase, chloroplastic;


Added to library: Sat Oct 27 08:34:35 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VTADPSPPTNKLNKYSSRITEPKSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLKLSEAV
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S






S
TTTS
GGGTT

TTGGGS



TT
TTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KEGVENAGMVGFRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISIPGCDKNMPGTI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT





TTSGGGGGT
S

SSS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence MAMGRLNRPGIMVYGGTIKPGGMYTANTMASAIEAMGMSLPYSSSIPAEDPLKLDECRLAGKYLLELLKM
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS










SSTTSS
TTTTTS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DLKPRDIITPKSLRNAMVSVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVSDAVPFLADLKPSGKYVM
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T

S
T

TTT



S
B
B
BTTTSSB
 .........290.........300.........310.........320.........330.........340.........350
Sequence EDIHKIGGTPAVLRYLLELGLMDGDCMTVTGQTLAQNLENVPSLTEGQEIIRPLSNPIKETGHIQILRGD
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTTT
S
TT
B
TTSSBTTS

S
TT
SSB

TTS
SBSS
S
BST
 .........360.........370.........380.........390.........400.........410.........420
Sequence LAPDGSVAKITGKEGLYFSGPALVFEGEESMLAAISADPMSFKGTVVVIRGEGPKGGPGMPEMLTPTSAI
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T
TT



S
S
SSS
GGGGTT

S
STTTTTS


 .........430.........440.........450.........460.........470.........480.........490
Sequence MGAGLGKECALLTDGRFSHGFVVGHICPEAQEGGPIGLIKNGDIITIDIGKKRIDTQVSPEEMNDRRKKW
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT
TTT
SS





SS
GGGT
GGGG

TT
TTTTSS

 .........500.........510.........520
Sequence TAPAYKVNRGVLYKYIKNVQSASDGCVTDE
Predicted secondary structure

















SS confidence





























Known secondary structure (DSSP)




S
SS


GGGTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D