Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ylwA_

Fold library idPDB HeaderMoleculeTitle
c5ylwA_1.70PDB header: oxidoreductaseChain: A: PDB Molecule: ferruginol synthase;


Added to library: Sat Oct 27 11:25:22 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LPPGPFPYPIVGNMLQLGANPHQVFAKLSKRYGPLMSIHLGSLYTVIVSSPEMAKEILHRHGQVFSGRTI
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)






BTTTBTGGG

S

STT
STTTTTTT
B


 .........80.........90.........100.........110.........120.........130.........140
Sequence AQAVHACDHDKISMGFLPVASEWRDMRKICKEQMFSNQSMEASQGLRRQKLQQLLDHVQKCSDSGRAVDI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
GGGGGGGGGGT
TTTS
SSTTTSTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence REAAFITTLNLMSATLFSSQATEFDSKATMEFKEIIEGVATIVGVPNFADYFPILRPFDPQGVKRRADVF
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)



SSTT
SS


GGGGGG
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence FGKLLAKIEGYLNERLESKRANPNAPKKDDFLEIVVDIIQANEFKLKTHHFTHLMLDLFVGGSDTNTTSI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTS



ST
SS

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence EWAMSELVMNPDKMARLKAELKSVAGDEKIVDESAMPKLPYLQAVIKEVMRIHPPGPLLLPRKAESDQEV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT
SS

GGGGGG


SSTT
S

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence NGYLIPKGTQILINAYAIGRDPSIWTDPETFDPERFLDNKIDFKGQDYELLPFGSGRRVCPGMPLATRIL
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TT
TT

T
TTTSSSTTS

GGGGTT



SSSS
TT

TT

GGG

TT
 .........430.........440.........450.........460......
Sequence HMATATLVHNFDWKLEDDSTAAADHAGELFGVAVRRAVPLRIIPIV
Predicted secondary structure




















SS confidence













































Known secondary structure (DSSP)
S

TT

SSS
SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D