Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yl7A_

Fold library idPDB HeaderMoleculeTitle
c5yl7A_1.40PDB header: hydrolaseChain: A: PDB Molecule: pseudoalteromonas arctica pamc 21717;


Added to library: Sat Feb 3 08:44:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STPNDPRFDDQWHYYEQAGGLNLPTAWDTATGSGVVVAVLDTGYRPHADLNANILPGYDMISNLSVANDG
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)




TTGGG

TTT


TT


TT
S
B


TTTGGGB







SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GGRDSDARDPGDAVAANECGTNGAQNSSWHGTHVAGTVAAVTNNGEGVAGVAYNAKVVPVRVLGKCGGLT
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) SSSBS

B




B
TTTTSS


B






SSSSS


TTTTS

BTTB

 .........150.........160.........170.........180.........190.........200.........210
Sequence SDIADGIIWASGGSVSGIPANSNPADVINMSLGGSGSCSSTTQNAINTARSNGTVVVIAAGNDNDNSANY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT


TTS


SS

S


S


TT


SSSSBGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence NPGNCNGVVNVASVGRNGGRAYYSNYGSNIDVAAPGGAQSFANDSEGVLSTYNSGSSTPSSDSYGYSQGT
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTTSSS

TTSSB
TT

BSTT





SSTT
TTS

SSS

S
S
 .........290.........300.........310.........320.........330.........
Sequence SMAAPHVAGVAALIKQAKPDATPDEIESILKSTTRSFPATCTSCGTGIVDAAAAVAAAS
Predicted secondary structure























SS confidence


























































Known secondary structure (DSSP) STT

T
B

SS

TT
TTSB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D