Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yl7A_

Fold library idPDB HeaderMoleculeTitle
c5yl7A_1.40PDB header: hydrolaseChain: A: PDB Molecule: pseudoalteromonas arctica pamc 21717;


Added to library: Sat Feb 3 08:44:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STPNDPRFDDQWHYYEQAGGLNLPTAWDTATGSGVVVAVLDTGYRPHADLNANILPGYDMISNLSVANDG
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)




TTGGG

TTT


TT


TT
S
B


TTTGGGB







SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GGRDSDARDPGDAVAANECGTNGAQNSSWHGTHVAGTVAAVTNNGEGVAGVAYNAKVVPVRVLGKCGGLT
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) SSSBS

B




B
TTTTSS


B






SSSSS


TTTTS

BTTB

 .........150.........160.........170.........180.........190.........200.........210
Sequence SDIADGIIWASGGSVSGIPANSNPADVINMSLGGSGSCSSTTQNAINTARSNGTVVVIAAGNDNDNSANY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT


TTS


SS

S


S


TT


SSSSBGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence NPGNCNGVVNVASVGRNGGRAYYSNYGSNIDVAAPGGAQSFANDSEGVLSTYNSGSSTPSSDSYGYSQGT
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) TTTSSS

TTSSB
TT

BSTT





SSTT
TTS

SSS

S
S
 .........290.........300.........310.........320.........330.........
Sequence SMAAPHVAGVAALIKQAKPDATPDEIESILKSTTRSFPATCTSCGTGIVDAAAAVAAAS
Predicted secondary structure























SS confidence


























































Known secondary structure (DSSP) STT

T
B

SS

TT
TTSB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D