Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yknA_

Fold library idPDB HeaderMoleculeTitle
c5yknA_2.30PDB header: gene regulationChain: A: PDB Molecule: probable lysine-specific demethylase jmj14;


Added to library: Sat Dec 30 08:31:44 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RWNPSEACRPLVDDAPIFYPTNEDFDDPLGYIEKLRSKAESYGICRIVPPVAWRPPCPLKEKKIWENSKF
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)


GGG










T
TTTS


TT




GGGSTT

B
 .........80.........90.........100.........110.........120.........130.........140
Sequence PTRIQFIDLLQNRFGFQTGPDFTLAAFQKYDEYFKECYFQPKVKDLEGEYWRIVEQATDEVEVYYGADLE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

GGGSS







B



S
SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence TKKFGSGFPKYKPGYPISEADQYSQCGWNLNNLSRLPGSVLAFESCDISGVIVPWLYVGMCFSTFCWHVE
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)

SS



TTS



TTSTTSTTBGGGG

S

BTTTB

TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence DHHLYSMNYLHTGDPKVWYGIPGNHAESFENVMKKRLPDLFEEQPDLLHQLVTQLSPRILKEEGVPVYRA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) GGG
S


GGGSTTSSSS
TT
TTT





TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence VQRSGEFILTFPKAYHSGFNCGFNCAEAVNVAPVDWLVHGQNAVEGYSKQRRKSSLSHDKLLLGAAMEAT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TT

TT

SSS
BGGGT


SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence YCLWELSLSKKKTPVIARWKRVCSEDGLLTKAVKKRVQMEEERLNHLQDGFSLRKMRECFLCFYDLHMSA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT



TT
SSS
S
SS



B
TTT

B
SS
 .........430.........440.........450.........460.........470........
Sequence SSCKCSPNRFACLIHAKDLCSCESKDRYILIRHTLDELWALVRALEGDLDAIDLWASK
Predicted secondary structure














SS confidence

























































Known secondary structure (DSSP) SSSTT

B
GGGSTTS



TTTSS
TT
T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D