Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yk2A_

Fold library idPDB HeaderMoleculeTitle
c5yk2A_2.81PDB header: transport proteinChain: A: PDB Molecule: probable conserved atp-binding protein abc transporter;


Added to library: Sat Feb 10 08:59:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKDEVTAELMEKAANQLFTVLGELKGGAMKVGQALSVMEAAIPDEFGEPYREALTKLAPPLPASKVHRVL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
TTSS
S
TTTTSTT



S

 .........80.........90.........100.........110.........120.........130.........140
Sequence DGQLGTKWRERFSSFNDTPVASASIGQVHKAIWSDGREVAVKIQYPGADEALRADLKTMQRMVGVLKQLS
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) T
TTGGGS
SS
S
SSTTS

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PGADVQGVVDELVERTEMELDYRLEAANQRAFAKAYHDHPRFQVPHVVASAPKVVIQEWIEGVPMAEIIR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT


TT
TSS
SS



SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence HGTTEQRDLIGTLLAELTFDAPRRLGLMHGDAHPGNFMLLPDGRMGIIDFGAVAPMPGGFPIELGMTIRL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S

S

GGG
TTS



TT

TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AREKNYDLLLPTMEKAGLIQRGRQVSVREIDEMLRQYVEPIQVEVFHYTRKWLQKMTVSQIDRTARQMDL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
TSB
TT



GGGGSSS

TT

S




B
SS
 .........360.........370.........380.........390.
Sequence PAKLAIPMRVIASVGAILCQLDAHVPIKALSEELIPGFAEP
Predicted secondary structure











SS confidence








































Known secondary structure (DSSP)
T

STTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D