Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yk2A_

Fold library idPDB HeaderMoleculeTitle
c5yk2A_2.81PDB header: transport proteinChain: A: PDB Molecule: probable conserved atp-binding protein abc transporter;


Added to library: Sat Feb 10 08:59:10 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKDEVTAELMEKAANQLFTVLGELKGGAMKVGQALSVMEAAIPDEFGEPYREALTKLAPPLPASKVHRVL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
TTSS
S
TTTTSTT



S

 .........80.........90.........100.........110.........120.........130.........140
Sequence DGQLGTKWRERFSSFNDTPVASASIGQVHKAIWSDGREVAVKIQYPGADEALRADLKTMQRMVGVLKQLS
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) T
TTGGGS
SS
S
SSTTS

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PGADVQGVVDELVERTEMELDYRLEAANQRAFAKAYHDHPRFQVPHVVASAPKVVIQEWIEGVPMAEIIR
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT


TT
TSS
SS



SS



 .........220.........230.........240.........250.........260.........270.........280
Sequence HGTTEQRDLIGTLLAELTFDAPRRLGLMHGDAHPGNFMLLPDGRMGIIDFGAVAPMPGGFPIELGMTIRL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S

S

GGG
TTS



TT

TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AREKNYDLLLPTMEKAGLIQRGRQVSVREIDEMLRQYVEPIQVEVFHYTRKWLQKMTVSQIDRTARQMDL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT
TSB
TT



GGGGSSS

TT

S




B
SS
 .........360.........370.........380.........390.
Sequence PAKLAIPMRVIASVGAILCQLDAHVPIKALSEELIPGFAEP
Predicted secondary structure











SS confidence








































Known secondary structure (DSSP)
T

STTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D