Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yjjE_

Fold library idPDB HeaderMoleculeTitle
c5yjjE_2.20PDB header: cytosolic proteinChain: E: PDB Molecule: polyribonucleotide nucleotidyltransferase;


Added to library: Sat Feb 3 08:23:36 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRFFPLTVNYEEKMYAADEATLTA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTSSS
TTSSTT
SS





GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence RLIDRPIRPLFPKGYRHDVQIMNIVLSADPDCSPEMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTSS
TT





TTS
TTSS





TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence INPSVADKEISRLDLEVAGHKDAVNMVEAGASEITESEMLEAIFFGHEEIKRLVAFQQEIIDHIQPIKQV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S

T
S
SS
SS







 .........220.........230.........240.........250.........260.........270.........280
Sequence YAILNDLIKEEVRRLIADEKIRPDGRKVDEIRPLESEVGLLPRAHGSGLFTRGQTQALSVLTLGARFMHH
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


TTS

TT






TTSSTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence YNFPNFSVGETGPVRAPGRREIGHGALGERALRYIIPDTQDFPYTIRIVSEVLESNGSSSQASICGSTLA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

GGGGT





S

TTS

TTT

S
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LMDAGVPIKAPVAGIAMGLVTRDDSYTILTDIQGMEDALGDMDFKVAGTKDGITAIQMDIKIDLTREVIE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT


SS


--
S

SS
SS
S



 .........430.........440.
Sequence EALEQARQGRLAIMDHMLHTI
Predicted secondary structure
SS confidence




















Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D