Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpH_

Fold library idPDB HeaderMoleculeTitle
c5yfpH_4.40PDB header: exocytosisChain: H: PDB Molecule: exocyst complex component exo84;


Added to library: Sat Feb 3 08:20:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NSTSLRKMLANPHFNAKDFVHDKLGNASAITIDKFTSNLTDLSIQVQEEVKLNINKSYNEIMTVNNDLNV
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
T




TTTTTTSS
SSSTTTTT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AMLELKRVRANINDLNEVLDQCTKIAEKRLQLQDQIDQERMRRDRSSVLILEKFWDTELDQLFKNVEGAQ
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTTTTT
TT







SSSSTTTSSSSSSSS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KFINSTKGRHILMNSANWMELNTTTGKPLQMVQIFILNDLVLIADKSRDKQNDFIVSQCYPLKDVTVTQE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S
STT
S

TT


TTT


SS
SS

SSSS
GGG



 .........220.........230.........240.........250.........260.........270.........280
Sequence EFSTKRLLFKFSNSNSSLYECRDADECSRLLDVIRKAKDDLCDIFHVEEENSKRIRESFRYLQSTQQTPG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS
SS



TT

BB

BSSSTTSSSSSSSSTTTS
SS
SS


 .........290.........300.........310.........320.........330.........340.........350
Sequence RENNRSPNKNKRRSMGGSITPDMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSLML
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT


SS

SS


TTTTT




TTTT
T


 .........360.........370.........380.........390.........400.........410.........420
Sequence LNLISLKIEQRREAISSKLSQSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIVDN
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTT
SSST
T



S
 .........430.........440.........450.........460.........470.........480.........490
Sequence PTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNLSPGSIKSSRK
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTT

ST




T
 .........500.........510........
Sequence QIDGLKAVGLDFVYKLDEFIKKNSDKIR
Predicted secondary structure





SS confidence



























Known secondary structure (DSSP) TTSS


T
STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D