Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpE_

Fold library idPDB HeaderMoleculeTitle
c5yfpE_4.40PDB header: exocytosisChain: E: PDB Molecule: exocyst complex component sec10;


Added to library: Sat Feb 3 08:25:41 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SLYELDPKWKKLLKTDNFLGGLTVNEFVQELSKDHRNDVLIDANTKNLPTNEKDQDAIREAIWKQLDPKP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

GGGSTTTTTS
STTSS




TTTTTTTTSS







SSTTSSSSTTSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence YIRTFESTLKELKNLNEETLNKRQYFSEQVATQEVIHSENVIKLSKDLHTTLLTFDKLDDRLTNVTQVVS
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)




T
 .........150.........160.........170.........180.........190.........200.........210
Sequence PLGDKLETAIKKKQNYIQSVELIRRYNDFYSMGKSDIVEQLRLSKNWKLNLKSVKLMKNLLILSSKLETS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TT

TTTTTT




STTTTT
SSSS

TTTTTTTTTS

SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence SIPKTINTKLVIEKYSEMMENELLENFNSAYRENNFTKLNEIAIILNNFNGGVNVIQSFINQHDYFIFIK
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
TTTS
SS

STTTTTTTTS

TTTTTTTSS




 .........290.........300.........310.........320.........330.........340.........350
Sequence NVKFKEQLIDFENHSVIIETSMQNLINDVETVIKNESKIVKRVFEEKATHVIQLFIQRVFAQKIEPRFEV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)

S


S

SSSSS
SS


SSS
SSSTTTTTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence LLRNSLSISNLAYVRILHGLFTLFGKFTKSLIDYFQLLEIDDSNQILSTTLEQCFADLFSHYLYDRSKYF
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
SS

TTTTT
TTSSTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GIEKRSLEAILVDMTSKFTVNYDKEINKRVLLDKYKEKLSTNTASDIDNSPNSPANYSLNDVDSMLKCVV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) SSSS
SSSS
TTTTTTTTTTT


SS
SS


S
SSSSS
 .........500.........510.........520.........530.........540.........550.........560
Sequence ESTARVMELIPNKAHLYILEILKIMFLGIVDSYMEIALEVAYWKICKVDINKTAGVVNLNFLKFISMSTE
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) S
STTTTTSTTTTTTTTTTTSTTS
S
TT

STTSSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence ILDLLSISIKSIFLPLLNNSPEIKAQIIEMTNSQIQKMEILINIILQETITVISTKFSAILCKQKKKDFV
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)

S
SSSTTTTTTTTTSST


TTTTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence PKSQELLDQDTLPAIEIVNILNLIFEQSSKFLKGKNLQTFLTLIGEELYGLLLSHYSHFQVNSIGGVVVT
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)


SSS

S

TTTTTTTTTTTS
STTTTTTTT



TT
 .........710.........720.........730.........740.........750.........760.........770
Sequence KDIIGYQTAIEDWGVASLIDKFATLRELANLFTVQPELLESLTKEGHLADIGRDIIQSYISNREDFNHDN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTTSSS

TTSSTTTTS


TTSSSSSTTSSGGGGS
SS
STTGGGSSSS
SSS
 ......
Sequence FINSVK
Predicted secondary structure
SS confidence





Known secondary structure (DSSP) TT
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D