Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpD_

Fold library idPDB HeaderMoleculeTitle
c5yfpD_4.40PDB header: exocytosisChain: D: PDB Molecule: exocyst complex component sec8;


Added to library: Sat Feb 3 08:25:18 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ETQQSAMNSSLDHLQNDLNRINLQWNRILSDNTNPLELALAFLDDTSVGLGHRYEEFNQLKSQIGSHLQD
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)






S
SSSTGGGGGTT


S
S
STTTTS
SSSS

SSTTTTSTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VVNEHSQVFNTNVASYGKAVSSIMQAQEQTLNLKNCLKEANEKITTDKGSLQELNDNNLKYTKMIDVLVN
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TTTTSTTTTTTTTTTTSSS
SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence IEELLQIPEKIEENIRKENFHQVQILLERGFILMNNKSLKTVEILKPINQQLELQEHLLFNNLIEEIHDI
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTSSTTTS


SSSSSSSSTTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence MYSKSNKTNFTRVTNNDIFKIISISHNGFTSLENYLYNIVNIDIMEHSKTINKNLEQFIHDQSLNKQENE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TS
SSSSSS


TTS


SSSS

SS


SS
SSSSS
S
TTTTTTTT


SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence GFNRIGFLLKTINNINKLPVAFNIITERAKEEIHNIIVKSTESIRSKHPSLLKMATSLKNDNHFGLPVQD
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TS
SSS



SGGGGG
TTT
TTTTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence ILSIILRECFWEIFLKLLYAIQCHRAIFEMSNILQPTSSAKPAFKFNKIWGKLLDEIELLLVRYINDPEL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SSTTTT
SS
S
TTTT

TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence ISSNNGSIKPINGEDNSSVKDQAFELKALLKDIFPGFSVSSNVPPSVFNMKVILDPFLLFTQSTSTIVPS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)









S



SSTTTTTSS










S
SS
S
TTTTTTGGGTSTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence VLTQNTISSLTFFDDYMNKSFLPKIQMTMDYLFTVEVESNNPYALELSDENHNIFKTALDFQRLFYNLLN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SSS
SS





SSTTTTTTTTS
TT
SS



TTS

S
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence VFNTANTFREKISYCILDLLNHFYNYYLGLFNSLIGTSDRHLTRKIITAWLQNGILMDQEQKILNGDETL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
SSSS
S
SSTTTT


S
SS


T

TTTTSSS
TT

 .........640.........650.........660.........670.........680.........690.........700
Sequence FHEESIELFKEIPHFYQAGKGLSKSDLFNNLTLDTILQFSASVLWILNWLPGLKKAINIDEVSQEPMLDA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTGGGGT
S
SS
S

SSSS


S


TTT




S


 .........710.........720.........730.........740.........750.........760.........770
Sequence DRLRSSWTFSESMDLNYSNPSSSPNSLGNLKILLDDKASKKFDETIDGFKTLKFKLITILRFNIRALCIY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSSTTS



STTT



SSS




TT

SS

TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence DIGSFFQNTKIWNMDVGSIELDQNIASLISELRRTESKLKQQLPEKEKNSIFIGLDIVNNYALIKGAKSI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) GGGGTTSS


SB

S





S
T

 .........850.........860.........870.........880.........890.........900.........910
Sequence KVLNHNGIKKMLRNVNVLQHAYRNLSSEPSKINMNVTMNFYSLCGSSEAELFEYIKDNELPHCSVEDLKT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS
B

TTT




TTSS



TT
 .........920.........930.........940.........950....
Sequence ILRLQFSEEMHRQLKRKEQSKEGARTKIGKLKSKLNAVHTANEK
Predicted secondary structure









SS confidence











































Known secondary structure (DSSP) TTTS






STTTTTTSS
TTS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D