Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpC_

Fold library idPDB HeaderMoleculeTitle
c5yfpC_4.40PDB header: exocytosisChain: C: PDB Molecule: exocyst complex component sec6;


Added to library: Sat Feb 3 08:26:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSSDPLQQVCDLIKGDLSLERVRDIKEQLLKEKSVVEYQLNKESDKYYGEVEESLKLLNLSKNSVTSIKQ
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)

SSSTT
SS
TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence QINEVNKLGNDNRFAINRYDILFRATKLYETVNTTSSIYDRIYNFVALMEHIERLLVAELAEDALETGCP
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TTTSSTTT
TTS
STTTTTGGG

TTTSTT

SS
TTTTT
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence HLLEIHFLLTSARDFQEQVVVMAKEATEDAQRTVMKLFSRLSGIISKFDKLLDGLTYDIVEMARAEQISL
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TTSSSTTTTSTTT
SSSS
SSTTTTTTTTTTTTTTTGGGSSS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence AIRLFKIYDLEEREDLRIEAIRNIIKKKEIEIEKSSIKKLPNSKNTARLQDETPKVIEYPTNKGLYQEIM
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTSSSSTTTGGGTTTSS
S
S

SSSSSSSTTS

TTTTTTTTTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence SGTISTRTAPRGYKHFLINGINNSISEMFGEMREKYVGDQKFDVLDNMDWIFNELIIVKEHIANCCPPHW
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) SSSS
S




SSSSTTTSTTSTTT

SS
TTTT

SSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence NIFEVYFDQYYKELHSLITDLVESEPETIIILDILAFDKTFQDTLKQDKSVIGDKEKETLFKDYLNLIVV
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) SSSTTTTSSS
S
GGGTTT






S
 .........430.........440.........450.........460.........470.........480.........490
Sequence KMTEWIGNLEKAEFDVFLERSTPPHSDSDGLLFLDGTKTCFQMFTQQVEVAAGTNQAKILVGVVERFSDL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) T
TTS
SBS
TTS

B
STTTT
TTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence LTKRQKNWISKISEEIKKQINYNHKYDIDPESITPEDECPGGLVEYLIAVSNDQMKAADYAVAISSKYGK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
-

S

--

STT


S


 .........570.........580.........590.........600.........610.........620.........630
Sequence LVSKVYEKQITNHLEGTLDGFAEVAQCSSLGLITLMFDDLRKPYQEIFSKTWYMGSQAQQIADTLDEYLL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) SS
TTTSTTTTT
TTTTSSSTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence DIKPQMNSVLFVNFIDNVIGETIIKFLTALSFEHSFKNKNNKFLEAMKRDFEIFYQLFVKVLDGNESKDT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TSGGG

TTS

TTS



TTGGGTTTS

SSS
TTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence LITQNFTVMEFFMDLSCEPIDSILDIWQKYLEVYWDSRIDLLVGILKCRKDVSSSERKKIVQQATEMLHE
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTS
GGGS

SS
TTTS
SSS
 .........780.........790....
Sequence YRRNMEADREPTLMRRFVLEFEKQ
Predicted secondary structure












SS confidence























Known secondary structure (DSSP) T






TTSS






-


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D