Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpB_

Fold library idPDB HeaderMoleculeTitle
c5yfpB_4.40PDB header: exocytosisChain: B: PDB Molecule: exocyst complex component sec5;


Added to library: Sat Feb 3 08:24:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDRFQIGDEQLLRFYQLKTINPTHSWAQDSSKKESRAYLNDESLSYIRDPLNGQEMSKELQHLPNDSMRL
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) -


SSTTTTTGGGT


TTS
SS



S




SSTTTTTSSTTTT
TTSSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NYLVNSKQFNVKAFLRDMHKQDSFNDLNNSLDRLDSDIQDQSIHLKQLVGKNFTKYVKIKNKLDQIYKEF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) SS
S
SSS

TTTS

SSS

SSSTTTTTTTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DEKTNEKNQCDSPKENQINVESLNKKVDEVIRTTTFKLKPLMDNYQKILNYQATKKFIELNKFYFNLPKS
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) STTSSSSSS
S
SSSTT
TTTTTTTT
SSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LKRCLTNNDFNEFIIEYSKGLTLRRRFNQSSDASQSLVIKRIWTQIENLLVTYKDLIWNSLINSNFNIDQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTSSS
STTTTTTT

TT
T

S
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence PQETILSLFSKLLNLENFIKNTTSSSNENPILRWMSIKMNGFQNELNELSGHMISKIIHSQRLILQNNTN
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)



S
SSTTTTTTTTTSTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence QDKSQGCVELSYYLKINQLFQIISDTGKDSEGLKSTVEPNKVNTISGTSYLNLNCQPSSQGLTDSPTIIE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SSS




TTTSSGGGTGGGSSS
SS


SS
S
SSSS




SS








SSTT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence MWLLILKYINDLWKICDQFIEFWEHIEKFLDGTYQNSIINEKRKENILIGDSNIIESYQKSLILKEEQIN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS
SSTTTTSSS









S


TTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence EVRLKGEEFITSVSQNLISFFTSSQSSLPSSLKDSTGDITRSNKDSGSPLDYGFIPPNCNGLSCLRYLPK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTSSSSTTSS




S









SSSSS
TT


SSS
SSSST
 .........570.........580.........590.........600.........610.........620.........630
Sequence IVEPILKFSTELAQLNITTNGITICRNTLSTIINRCVGAISSTKLRDISNFYQLENWQVYETVTFSSKSQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S

SSSSTTSSTTT

S
S
S






T
 .........640.........650.........660.........670.........680.........690.........700
Sequence DSSKNLTFEYGVTQFPEIVTSFQEVSIKTTRDLLFAYEKLPIINGISVVSYPSKQLLTGIEIQQIISMEA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T









TTTTGGGSTT

TT



S
TT

 .........710.........720.........730.........740.........750.........760.........770
Sequence VLEAILKNAAKDKDNPRNSHTILTLTNLQYFRECAFPNILQYFDDAFEWNLASKNLELFSLLSKMESSIF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S
S
SSSSTTTTTTGGGSS

S
S

TTTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence GNYLSDLKINLRDTLEEKFHEINWPMYTSNSFRVGDYIIEALMILIVVHSECFRIGPQLIHKILIETQIF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTSSSTTSS





S


TTTTSTTSTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence IARYLFEAFKPYVGNLSNDGSLQIIVDLEFFQKVMGPLLEKDTEATLRACLQNCFQNDTNRLQKCINEIN
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TSSSTT
STTTTTTTTT
SS

STSSSSSSSS
 .........920........
Sequence PIVSANLKRTAIQFAAFS
Predicted secondary structure

SS confidence

















Known secondary structure (DSSP) TTTT
TTGGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D