Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpB_

Fold library idPDB HeaderMoleculeTitle
c5yfpB_4.40PDB header: exocytosisChain: B: PDB Molecule: exocyst complex component sec5;


Added to library: Sat Feb 3 08:24:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDRFQIGDEQLLRFYQLKTINPTHSWAQDSSKKESRAYLNDESLSYIRDPLNGQEMSKELQHLPNDSMRL
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) -


SSTTTTTGGGT


TTS
SS



S




SSTTTTTSSTTTT
TTSSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NYLVNSKQFNVKAFLRDMHKQDSFNDLNNSLDRLDSDIQDQSIHLKQLVGKNFTKYVKIKNKLDQIYKEF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) SS
S
SSS

TTTS

SSS

SSSTTTTTTTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DEKTNEKNQCDSPKENQINVESLNKKVDEVIRTTTFKLKPLMDNYQKILNYQATKKFIELNKFYFNLPKS
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) STTSSSSSS
S
SSSTT
TTTTTTTT
SSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LKRCLTNNDFNEFIIEYSKGLTLRRRFNQSSDASQSLVIKRIWTQIENLLVTYKDLIWNSLINSNFNIDQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTSSS
STTTTTTT

TT
T

S
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence PQETILSLFSKLLNLENFIKNTTSSSNENPILRWMSIKMNGFQNELNELSGHMISKIIHSQRLILQNNTN
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)



S
SSTTTTTTTTTSTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence QDKSQGCVELSYYLKINQLFQIISDTGKDSEGLKSTVEPNKVNTISGTSYLNLNCQPSSQGLTDSPTIIE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SSS




TTTSSGGGTGGGSSS
SS


SS
S
SSSS




SS








SSTT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence MWLLILKYINDLWKICDQFIEFWEHIEKFLDGTYQNSIINEKRKENILIGDSNIIESYQKSLILKEEQIN
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS
SSTTTTSSS









S


TTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence EVRLKGEEFITSVSQNLISFFTSSQSSLPSSLKDSTGDITRSNKDSGSPLDYGFIPPNCNGLSCLRYLPK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTSSSSTTSS




S









SSSSS
TT


SSS
SSSST
 .........570.........580.........590.........600.........610.........620.........630
Sequence IVEPILKFSTELAQLNITTNGITICRNTLSTIINRCVGAISSTKLRDISNFYQLENWQVYETVTFSSKSQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S

SSSSTTSSTTT

S
S
S






T
 .........640.........650.........660.........670.........680.........690.........700
Sequence DSSKNLTFEYGVTQFPEIVTSFQEVSIKTTRDLLFAYEKLPIINGISVVSYPSKQLLTGIEIQQIISMEA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) T









TTTTGGGSTT

TT



S
TT

 .........710.........720.........730.........740.........750.........760.........770
Sequence VLEAILKNAAKDKDNPRNSHTILTLTNLQYFRECAFPNILQYFDDAFEWNLASKNLELFSLLSKMESSIF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S
S
SSSSTTTTTTGGGSS

S
S

TTTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence GNYLSDLKINLRDTLEEKFHEINWPMYTSNSFRVGDYIIEALMILIVVHSECFRIGPQLIHKILIETQIF
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTSSSTTSS





S


TTTTSTTSTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence IARYLFEAFKPYVGNLSNDGSLQIIVDLEFFQKVMGPLLEKDTEATLRACLQNCFQNDTNRLQKCINEIN
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TSSSTT
STTTTTTTTT
SS

STSSSSSSSS
 .........920........
Sequence PIVSANLKRTAIQFAAFS
Predicted secondary structure

SS confidence

















Known secondary structure (DSSP) TTTT
TTGGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D