Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpA_

Fold library idPDB HeaderMoleculeTitle
c5yfpA_4.40PDB header: exocytosisChain: A: PDB Molecule: exocyst complex component sec3;


Added to library: Sat Feb 3 08:24:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ESKEEIKTMENIDDEVLLEILTDINWSIEDDADSMIERIDLRLAETEYLFNQNLLSLQKIGPNIRPYEDK
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)






SS
S
SSSTSS

SS

TTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VNDECHRIIPTLSLFLMEMSNFSNDIENVESQDNGLQVESANKKLLWNTLDELLKTVSLDEISLNQLLEC
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) T
SS

TTTSSTTTTS
TTTTS








SS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PIREKNLPWMENQLNLLLKAFQAIGSDGNEVEYNLREISGLKQRLQFYEKVTKIFLNRIVEEMQKKFSNI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
S
SSS





S
TTS

TTTT
SSTTGGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RGQDISHDQMIRILTTLLIFSPLILFCKEISQKSYQAIVENWNVSIQPVYMELWTKKISQLQGIDTNDEK
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)


STT

STT
TTTS
TTS
TTTSTT




S

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence MNELSLSQLLNEWDTFRKERKTNDINPVFKNSFSLLTECLQTMRQECIVYQNFVEVFFHISSKHNFEEYI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTTSSSTTTT
SSSS
S
SS


STTSSSSSSTTTSTTSSSSSSSSSSSS




SSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KHFNDPDAPPILLDTVKVMQSDREAAVIETQLVSRIFQPIVTRLSSYFVELVKAEPTVAPALTFYLENEI
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)





S












T
S
SSTTSTTTS
SS
SSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence KSLESSNHEFLLSAVTRMYTQIKQVWSDNVEEQVLHFERISNATTNGEILPGILDLPVGLKNSEDLFQFA
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTTS
S
S
TTTTTTSTTS
TTTTSTTTT

S



TTTTTTSTTTTTTG
 .........500.........510.........520.........530.........540.........550.........560
Sequence KRSMDIKDTDEGYESIELMNSSFRKLSIAATRSITDYMETISLLVNSNWLTEMLSMDGIFDTSLQNVKKV
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) GG

SSSSSSSS


SSSTTTS


TTTTTTTB

B

S
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence FDVEKESYASFLLRDTMPKLTAFVYGVSNIIENRQNLENILLAYTSHEIETLVKRLHTHMVNDFGYHQEN
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTT
SSSTTTTTTTSS



SS


SS

SSS
TTTTTTSSSSS
SS
SSSS

S
 .........640.........650.........660.........670..
Sequence AINNVLCDKLWSCIQGQTVSLYLKLYTVIDKHKNDIISAFEE
Predicted secondary structure



SS confidence









































Known secondary structure (DSSP)


SSSTTTTTTSSGGGSS




TTTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D