Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfpA_

Fold library idPDB HeaderMoleculeTitle
c5yfpA_4.40PDB header: exocytosisChain: A: PDB Molecule: exocyst complex component sec3;


Added to library: Sat Feb 3 08:24:28 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ESKEEIKTMENIDDEVLLEILTDINWSIEDDADSMIERIDLRLAETEYLFNQNLLSLQKIGPNIRPYEDK
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)






SS
S
SSSTSS

SS

TTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VNDECHRIIPTLSLFLMEMSNFSNDIENVESQDNGLQVESANKKLLWNTLDELLKTVSLDEISLNQLLEC
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) T
SS

TTTSSTTTTS
TTTTS








SS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PIREKNLPWMENQLNLLLKAFQAIGSDGNEVEYNLREISGLKQRLQFYEKVTKIFLNRIVEEMQKKFSNI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
S
SSS





S
TTS

TTTT
SSTTGGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence RGQDISHDQMIRILTTLLIFSPLILFCKEISQKSYQAIVENWNVSIQPVYMELWTKKISQLQGIDTNDEK
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)


STT

STT
TTTS
TTS
TTTSTT




S

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence MNELSLSQLLNEWDTFRKERKTNDINPVFKNSFSLLTECLQTMRQECIVYQNFVEVFFHISSKHNFEEYI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTTSSSTTTT
SSSS
S
SS


STTSSSSSSTTTSTTSSSSSSSSSSSS




SSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KHFNDPDAPPILLDTVKVMQSDREAAVIETQLVSRIFQPIVTRLSSYFVELVKAEPTVAPALTFYLENEI
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)





S












T
S
SSTTSTTTS
SS
SSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence KSLESSNHEFLLSAVTRMYTQIKQVWSDNVEEQVLHFERISNATTNGEILPGILDLPVGLKNSEDLFQFA
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTTTS
S
S
TTTTTTSTTS
TTTTSTTTT

S



TTTTTTSTTTTTTG
 .........500.........510.........520.........530.........540.........550.........560
Sequence KRSMDIKDTDEGYESIELMNSSFRKLSIAATRSITDYMETISLLVNSNWLTEMLSMDGIFDTSLQNVKKV
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) GG

SSSSSSSS


SSSTTTS


TTTTTTTB

B

S
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence FDVEKESYASFLLRDTMPKLTAFVYGVSNIIENRQNLENILLAYTSHEIETLVKRLHTHMVNDFGYHQEN
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TTTT
SSSTTTTTTTSS



SS


SS

SSS
TTTTTTSSSSS
SS
SSSS

S
 .........640.........650.........660.........670..
Sequence AINNVLCDKLWSCIQGQTVSLYLKLYTVIDKHKNDIISAFEE
Predicted secondary structure



SS confidence









































Known secondary structure (DSSP)


SSSTTTTTTSSGGGSS




TTTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D