Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5yfcB_

Fold library idPDB HeaderMoleculeTitle
c5yfcB_1.76PDB header: hydrolaseChain: B: PDB Molecule: dipeptidyl peptidase 3;


Added to library: Sat Jan 6 08:18:45 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VHRERFLADKSAPLCGMDIRKSFDQLSSKEKLYTHYVTEASWAGARIIQAQWTPQATDLYDLLILTFSVN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

GGGTB

SS




TS
TT
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GKLADLNALKTSSGLSEDDWEALIQYTVQVLSNLVNYKTFGFTKIIPRVDAEKFESVVKASSNADQGSAL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T

T

TSSB
TTT
BB
B
SS
STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTKLKQHIYALSPESALFIGKRKDGHVSNYYLGEPVGDAEVDAIQNVAEKLGVDILNTRVKKNGAGDYTL
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


SGGGGBBS
GGGT
B
TTS


T

STTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LVASAKTSPPSVHDFQIDSTPAKLTIEYGDYASSLTKVVAALQEAKQYTANDHQSAMIEGYVKSFNSGSI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SS



TTTTT
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence PEHKAASTEWVKDIGPVVESYIGFVETYVDPYGGRAEWEGFTAIVDKQLSAKYEALVNGAPKLIKSLPWG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TS
S
S
SSSTTS


TTTTTSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence TDFEVDVFRKPDFTALEVVSFATGGIPAGINIPNYYEVRESTGFKNVSLANILAAKVPNEELTFIHPDDV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) GGGS
SS



SSS

S


T

T


TT



SB
GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence ELYNAWDSRAFELQVANHELLGHGSGKLFQEGADGKLNFDPEKVINPLTGKPITSWYKPGQTPDSVLGEV
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTTT




BB
TTS
BSS
TTT


TTT






B
TT

GGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence SSSMEECRAETVALYLVSNLDILKIFNYVDKQDIEDIQYITFLLMARAGLRALEFYDPATKKHGQAHMQA
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TT
TT

SGGGGTTTTS
 .........570.........580.........590.........600.........610.........620.........630
Sequence RMGITQYLIQAGIARLELIQDANGELENLYVRVDREKVLSKGKEVVGQLLIELQVRKSTADGTGSRDFYT
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTS
TTS

TT
 .........640.........650.........660.........670.........680.........690
Sequence TLTEPISGWEGKIRDIVLKKKLPRKIFVQPNTFVVNGEVQLKEYPLTAAGVIESFIERRL
Predicted secondary structure




















SS confidence



























































Known secondary structure (DSSP) TS

TTTTTT






TT


SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D