Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ye2B_

Fold library idPDB HeaderMoleculeTitle
c5ye2B_5.80PDB header: membrane proteinChain: B: PDB Molecule: mammalian endo-lysosomal trpml1 channel;


Added to library: Sat Dec 30 08:32:18 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDGSDDTFAAYTQEQLYQAIF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

TT

TTGGGG
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPANDTFDIDPRVVTDCIQVDPPNL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS

B





SS
SS

S
SS
TTTT










 .........150.........160.........170.........180.........190.........200.........210
Sequence TLKFHKLINVTIHFQLKTINLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTHIQECKHPSFRL
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


TTT
GGGGTTT




SS
SS


S


 .........220.........230.........240.........250.........260.........270.........280
Sequence LFDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFFVNGWYILLVTSDVLTISGTVMKIGIEAKNLASYDV
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)




TTTTGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence CSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFR
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) SSSTTTTTS
SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence SLSMVSECLFSLINGDDMFVTFAAMQAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIK
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) SSTTTTTS
SS

TTTTTT
 ....
Sequence HPGG
Predicted secondary structure

SS confidence



Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D