Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y9wA_

Fold library idPDB HeaderMoleculeTitle
c5y9wA_1.85PDB header: transferaseChain: A: PDB Molecule: pollen receptor-like kinase 6;


Added to library: Sat Dec 30 08:44:33 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YVSESEPLVRFKNSVKITKGDLNSWREGTDPCSGKWFGIYCQKGLTVSGIHVTRLGLSGTITVDDLKDLP
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
GGGSSSS

TT

TTS
TTSS
STTTTT

SS



STTGGG
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence NLKTIRLDNNLLSGPLPHFFKLRGLKSLMLSNNSFSGEIRDDFFKDMSKLKRLFLDHNKFEGSIPSSITQ
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) T



SSS


GGG
TT



SS

TTTTTT
TT



SSS


GGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence LPQLEELHMQSNNLTGEIPPEFGSMKNLKVLDLSTNSLDGIVPQSIADKKNLAVNLTENEYLCGPVVDVG
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP)
TT



SS


SB

GGGGG
SS



SS

BS


S
SS


S
GGG
SS




 ...
Sequence CEN
Predicted secondary structure


SS confidence


Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D