Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y9wA_

Fold library idPDB HeaderMoleculeTitle
c5y9wA_1.85PDB header: transferaseChain: A: PDB Molecule: pollen receptor-like kinase 6;


Added to library: Sat Dec 30 08:44:33 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YVSESEPLVRFKNSVKITKGDLNSWREGTDPCSGKWFGIYCQKGLTVSGIHVTRLGLSGTITVDDLKDLP
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
GGGSSSS

TT

TTS
TTSS
STTTTT

SS



STTGGG
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence NLKTIRLDNNLLSGPLPHFFKLRGLKSLMLSNNSFSGEIRDDFFKDMSKLKRLFLDHNKFEGSIPSSITQ
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) T



SSS


GGG
TT



SS

TTTTTT
TT



SSS


GGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence LPQLEELHMQSNNLTGEIPPEFGSMKNLKVLDLSTNSLDGIVPQSIADKKNLAVNLTENEYLCGPVVDVG
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP)
TT



SS


SB

GGGGG
SS



SS

BS


S
SS


S
GGG
SS




 ...
Sequence CEN
Predicted secondary structure


SS confidence


Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D