Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y9vA_

Fold library idPDB HeaderMoleculeTitle
c5y9vA_2.84PDB header: transport proteinChain: A: PDB Molecule: ryanodine receptor 1;


Added to library: Sat Dec 23 08:27:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIQDKNIPPDLSQCVFVIEQALSVRALQELVTGH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

B
BTT
TT

SS

B
TTSSSSS

GGG





 .........80.........90.........100.........110.........120.........130.........140
Sequence RTLLYGNAILLRHLNSDMYLACLSTSSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVRVGDDL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
B
BTT
TTT


S


SSSTT
S


SSTTSSSSS
TTSB
BTT
 .........150.........160.........170.......
Sequence ILVSVATERYLHTTKENEVSIVNASFHVTHWSVQPYG
Predicted secondary structure












SS confidence




































Known secondary structure (DSSP) TTTS
SSSSSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D